(data stored in ACNUC30630 zone)

EMBL: CP001977.PE593

CP001977.PE593       Location/Qualifiers
FT   CDS             630710..632698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3613"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="identified by match to protein family HMM PF03169;
FT                   match to protein family HMM TIGR00728; match to protein
FT                   family HMM TIGR00733"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99508"
FT                   /db_xref="GOA:D4HC71"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC71"
FT                   /protein_id="ADD99508.1"
FT                   /translation="MSDLSSSSAPARRPGTSVRELTFRGIVLGGLMTLIFTAANVYLGL
FT                   KVGLTFATSIPAAVISMAVLRHFKGHSVEENNIVQTIASAAGTLSAIIFVLPGLIMVGW
FT                   WSGFPYWTTLAICLVGGILGVMYSIPLRRALVTGSDLPYPEGVAGAEVLKVGDSAGAAE
FT                   ANKVGLRVIIVGSVVSAAYALLSDLKLVKSALTKPFKTGDSSGSMVGVSMSMALIGVGH
FT                   LVGIAVAAAILVGLFISYGAILPWRVSGKVGSDLTVIQDVFTSDVRFVGAGTIGVAAIW
FT                   TLVKVIGPIVKGISDSISSSKTRHEGGEVPLTERDLPVSVVLTVVLISMIPIGFMLWGF
FT                   ARDMVVSRSMTGVIIVSLAFILLVGLAVASVCGYMAGLIGASNSPISGVGILVVLVAAL
FT                   LIKLTYGAVGGGETVKLVAYTLFTASIVFGIATISNDNLQDLKTGQLVGSTPWKQQIAL
FT                   IIGVIFGSAIIPPVMQLMQSAFGFQGAPGAGPNALQAPQATLISSLATGVFGGALDWGL
FT                   MGIGALVGIGVIVVDEILTHTTKKFSLPPLAVGMGMYLPMTLSLTIPIGAALGWLFDKW
FT                   AAHTAGDVEGKKRTGILLATGLIVGESIFGVIYAAMIAAAGSEDAIAIAPESWDSGAGI
FT                   VGVITFAAAIAFLYRWTKRQAKERVEA"
     MSDLSSSSAP ARRPGTSVRE LTFRGIVLGG LMTLIFTAAN VYLGLKVGLT FATSIPAAVI        60
     SMAVLRHFKG HSVEENNIVQ TIASAAGTLS AIIFVLPGLI MVGWWSGFPY WTTLAICLVG       120
     GILGVMYSIP LRRALVTGSD LPYPEGVAGA EVLKVGDSAG AAEANKVGLR VIIVGSVVSA       180
     AYALLSDLKL VKSALTKPFK TGDSSGSMVG VSMSMALIGV GHLVGIAVAA AILVGLFISY       240
     GAILPWRVSG KVGSDLTVIQ DVFTSDVRFV GAGTIGVAAI WTLVKVIGPI VKGISDSISS       300
     SKTRHEGGEV PLTERDLPVS VVLTVVLISM IPIGFMLWGF ARDMVVSRSM TGVIIVSLAF       360
     ILLVGLAVAS VCGYMAGLIG ASNSPISGVG ILVVLVAALL IKLTYGAVGG GETVKLVAYT       420
     LFTASIVFGI ATISNDNLQD LKTGQLVGST PWKQQIALII GVIFGSAIIP PVMQLMQSAF       480
     GFQGAPGAGP NALQAPQATL ISSLATGVFG GALDWGLMGI GALVGIGVIV VDEILTHTTK       540
     KFSLPPLAVG MGMYLPMTLS LTIPIGAALG WLFDKWAAHT AGDVEGKKRT GILLATGLIV       600
     GESIFGVIYA AMIAAAGSED AIAIAPESWD SGAGIVGVIT FAAAIAFLYR WTKRQAKERV       660
     EA                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page