(data stored in ACNUC30630 zone)

EMBL: CP001977.PE600

CP001977.PE600       Location/Qualifiers
FT   CDS             638659..639288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99514"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC78"
FT                   /protein_id="ADD99514.1"
FT                   /translation="MTTDLDRVRINCSGRRIRLIGDRSIPGVQIGGKHTRRRIGRVVEI
FT                   GIDGHLAPDLGVLKRFRFPTGMDGVKDLSFGREVTVRVHSDLPVDIELSGGSLRASGVE
FT                   RFGRVRVTAGVTEIDGVHQIEDGLFQAGSGSITGRIDTGRSQIRVESGNLNIKLAGGSN
FT                   VSVRGKAQTGMISWPEGGEVDEYVMGNGSARLDLTCLVGRIAVRAL"
     MTTDLDRVRI NCSGRRIRLI GDRSIPGVQI GGKHTRRRIG RVVEIGIDGH LAPDLGVLKR        60
     FRFPTGMDGV KDLSFGREVT VRVHSDLPVD IELSGGSLRA SGVERFGRVR VTAGVTEIDG       120
     VHQIEDGLFQ AGSGSITGRI DTGRSQIRVE SGNLNIKLAG GSNVSVRGKA QTGMISWPEG       180
     GEVDEYVMGN GSARLDLTCL VGRIAVRAL                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page