(data stored in ACNUC30630 zone)

EMBL: CP001977.PE603

CP001977.PE603       Location/Qualifiers
FT   CDS             640642..642657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3623"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03190"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98957"
FT                   /db_xref="GOA:D4HC81"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC81"
FT                   /protein_id="ADD98957.1"
FT                   /translation="MPNYLGESTSPYLIQHAANPVDWFPWGEEAFDEARSRDVPVMVSV
FT                   GYSSCHWCHVMALESFSDPEVAEVVNANVVPVKVDREERPEVDAALMQVTLAMTGQGGW
FT                   PNTVFLTPEGKPFFAGTYFPPVRRGRLPGFVELVEALGGAWRERRDEVVSSAEAIVEHL
FT                   RPVEKDPEVARPIAGELIDAVGADYDIVHGGFGSPTKFPMPTLLDALLVKGDPTSLDMA
FT                   QNTCEHLVRGGIFDQVGGGFHRYSTDSQWVVPHFEKMLYDNALLLATMARCWRRTADHD
FT                   SDRRDLYSHAARRTVAWLNREMRLPNGLYAAGLDADSDDAAGHTHEGIYYLWNQDLITD
FT                   ALGTDEAEWLRPLVHLEPCNDNGLGTLQLRGRVEWERINADMDTLLEARGRRSAPARDE
FT                   KAITAWNAMLIDGLVEAGMILREWSWVEQARELADSLWTAHWDHGMALRTSFHDRPGVP
FT                   AVCEDYAWVALSFAGLAGATGESVWLDHAVEVLGEAVARFSAVDGSFLDAEDSFLLTVT
FT                   AHTLTDDACPSPTAAMVMALRRVGLMAERADFIERANKASVALLPVVSATPRFAGWAVA
FT                   DFLITDEARRGLKPAGVVIADTTDEPSDLAAAAWRMAPAGSAIMRRLNEDSGFGTWFNE
FT                   RVPRDGQPTCWVCRGAVCFEPVTDYLDLKEPLWRRA"
     MPNYLGESTS PYLIQHAANP VDWFPWGEEA FDEARSRDVP VMVSVGYSSC HWCHVMALES        60
     FSDPEVAEVV NANVVPVKVD REERPEVDAA LMQVTLAMTG QGGWPNTVFL TPEGKPFFAG       120
     TYFPPVRRGR LPGFVELVEA LGGAWRERRD EVVSSAEAIV EHLRPVEKDP EVARPIAGEL       180
     IDAVGADYDI VHGGFGSPTK FPMPTLLDAL LVKGDPTSLD MAQNTCEHLV RGGIFDQVGG       240
     GFHRYSTDSQ WVVPHFEKML YDNALLLATM ARCWRRTADH DSDRRDLYSH AARRTVAWLN       300
     REMRLPNGLY AAGLDADSDD AAGHTHEGIY YLWNQDLITD ALGTDEAEWL RPLVHLEPCN       360
     DNGLGTLQLR GRVEWERINA DMDTLLEARG RRSAPARDEK AITAWNAMLI DGLVEAGMIL       420
     REWSWVEQAR ELADSLWTAH WDHGMALRTS FHDRPGVPAV CEDYAWVALS FAGLAGATGE       480
     SVWLDHAVEV LGEAVARFSA VDGSFLDAED SFLLTVTAHT LTDDACPSPT AAMVMALRRV       540
     GLMAERADFI ERANKASVAL LPVVSATPRF AGWAVADFLI TDEARRGLKP AGVVIADTTD       600
     EPSDLAAAAW RMAPAGSAIM RRLNEDSGFG TWFNERVPRD GQPTCWVCRG AVCFEPVTDY       660
     LDLKEPLWRR A                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page