(data stored in ACNUC30630 zone)

EMBL: CP001977.PE610

CP001977.PE610       Location/Qualifiers
FT   CDS             complement(647995..649932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3630"
FT                   /product="phosphoesterase family"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM TIGR02276"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99911"
FT                   /db_xref="GOA:D4HC88"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC88"
FT                   /protein_id="ADD99911.1"
FT                   /translation="MVDVASHRQTATIPVNRNGSKLVGANPTGLALSQDGKRLYVTNSG
FT                   HNEVAVINAATRKVIGDIPTGWYPTQVLAHDGKLSITSAKGLGAGPNNGPGHPNPTDPR
FT                   DTAENQYSGSMIKGLLSTVSEPDAATLAKLTATVEKNNTANDPARSSAVPNQIGTTSSK
FT                   IKHVIYIVRENRTFDQELGSNGRGNADPSLNLFGEESAPNTRALARQFTTFDNFYADAE
FT                   VSANGWNWVSQANSNPWSEEMWPSNYSGRGAPYPAESNDPDSRAKEHDSYFWEHLSKNN
FT                   ISFRNYGFYTTLDKKGKAHGVDKKILDPNTDHDFIGWSLDCPDSARSFAPMAKNCGPKS
FT                   RVDEWKSDFNKQLAKGSVPTVQLVRFGNDHTQATKVGVPTPQAYVADNDQAIGQLVETV
FT                   SHSPIWKDTAIFLTEDDAQNGPDHVDAHRTIGEVISPYTRTGGVDSTFYSTVSMLHTME
FT                   GILGIGPLTQFDAFSTPMSAAFTDKPDLTPYQAASPSYDMKTLNTPKAPMAKESGEQDT
FT                   TKEDDIDEQVFNKAIWKAVKGARSTMPEPKHSVIQSGPVLTYDDDDDEGEKLKPGDVDL
FT                   DELGSYSKDAKGFPVWTPDDKRFDPAQGIDPCSPKPGPTLTPTVPTAVMPSNSTHRGEG
FT                   RHPGLPRTGV"
     MVDVASHRQT ATIPVNRNGS KLVGANPTGL ALSQDGKRLY VTNSGHNEVA VINAATRKVI        60
     GDIPTGWYPT QVLAHDGKLS ITSAKGLGAG PNNGPGHPNP TDPRDTAENQ YSGSMIKGLL       120
     STVSEPDAAT LAKLTATVEK NNTANDPARS SAVPNQIGTT SSKIKHVIYI VRENRTFDQE       180
     LGSNGRGNAD PSLNLFGEES APNTRALARQ FTTFDNFYAD AEVSANGWNW VSQANSNPWS       240
     EEMWPSNYSG RGAPYPAESN DPDSRAKEHD SYFWEHLSKN NISFRNYGFY TTLDKKGKAH       300
     GVDKKILDPN TDHDFIGWSL DCPDSARSFA PMAKNCGPKS RVDEWKSDFN KQLAKGSVPT       360
     VQLVRFGNDH TQATKVGVPT PQAYVADNDQ AIGQLVETVS HSPIWKDTAI FLTEDDAQNG       420
     PDHVDAHRTI GEVISPYTRT GGVDSTFYST VSMLHTMEGI LGIGPLTQFD AFSTPMSAAF       480
     TDKPDLTPYQ AASPSYDMKT LNTPKAPMAK ESGEQDTTKE DDIDEQVFNK AIWKAVKGAR       540
     STMPEPKHSV IQSGPVLTYD DDDDEGEKLK PGDVDLDELG SYSKDAKGFP VWTPDDKRFD       600
     PAQGIDPCSP KPGPTLTPTV PTAVMPSNST HRGEGRHPGL PRTGV                       645
//

If you have problems or comments...

PBIL Back to PBIL home page