(data stored in ACNUC30630 zone)

EMBL: CP001977.PE63

CP001977.PE63        Location/Qualifiers
FT   CDS             64722..65777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01216"
FT                   /db_xref="GOA:D4HEM1"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM1"
FT                   /protein_id="ADE01216.1"
FT                   /translation="MKLLLVCIDGLRLDIALPEALQRDPGFTHPDHPADPRFVRGVGQG
FT                   EPVPEHPAPALDHTLPVDRAPKNLAPTLARLVRGDDRSQGTIIPMWMTPPTDSAPGWTT
FT                   ILTGATHEQCNVWWNEFVGHDLARHPDILSQVFFANPSARTLAAATWDAFVSPYGPGPI
FT                   IHQRVDQQRTGQHQLFGPDLSQGIDRADEQVSSWAAWHLLHEGPDAAVVYFEGVDHAGH
FT                   SFGADSEQYQQAVGHVDELTRHLVKAVAERHEQLGEQWLVAVTTDHGHKPEGGHGEDEV
FT                   EVRRSFLAAHHIGGTLPEPLLRTAALRSHEVTPLLLQAMGVHPGHMDASDVGVLRDVEP
FT                   IGPSREMDFEW"
     MKLLLVCIDG LRLDIALPEA LQRDPGFTHP DHPADPRFVR GVGQGEPVPE HPAPALDHTL        60
     PVDRAPKNLA PTLARLVRGD DRSQGTIIPM WMTPPTDSAP GWTTILTGAT HEQCNVWWNE       120
     FVGHDLARHP DILSQVFFAN PSARTLAAAT WDAFVSPYGP GPIIHQRVDQ QRTGQHQLFG       180
     PDLSQGIDRA DEQVSSWAAW HLLHEGPDAA VVYFEGVDHA GHSFGADSEQ YQQAVGHVDE       240
     LTRHLVKAVA ERHEQLGEQW LVAVTTDHGH KPEGGHGEDE VEVRRSFLAA HHIGGTLPEP       300
     LLRTAALRSH EVTPLLLQAM GVHPGHMDAS DVGVLRDVEP IGPSREMDFE W                351
//

If you have problems or comments...

PBIL Back to PBIL home page