(data stored in ACNUC30630 zone)

EMBL: CP001977.PE64

CP001977.PE64        Location/Qualifiers
FT   CDS             65771..66415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3064"
FT                   /product="HAD hydrolase, family IA, variant 3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98939"
FT                   /db_xref="GOA:D4HEM2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM2"
FT                   /protein_id="ADD98939.1"
FT                   /translation="MVTMYPPQQVDAVLFDMDGTLLNTLSAWCVASEHLWGTSLADADS
FT                   AKVDGGTVDDVVELYLRDHPQADPQATVERFMDILDANLAGNTEPMPGADRLVKRLSGH
FT                   VPIAVVSNSPTRLVRDGLASQGWLELFDTVLGVDEVAAGKPAPDPYLTAARRLGADPSR
FT                   CVVIEDSSFGLRAGRAAGAWVLTVGRRLKGQGDMWVSGLDDERVTSWEPHR"
     MVTMYPPQQV DAVLFDMDGT LLNTLSAWCV ASEHLWGTSL ADADSAKVDG GTVDDVVELY        60
     LRDHPQADPQ ATVERFMDIL DANLAGNTEP MPGADRLVKR LSGHVPIAVV SNSPTRLVRD       120
     GLASQGWLEL FDTVLGVDEV AAGKPAPDPY LTAARRLGAD PSRCVVIEDS SFGLRAGRAA       180
     GAWVLTVGRR LKGQGDMWVS GLDDERVTSW EPHR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page