(data stored in ACNUC30630 zone)

EMBL: CP001977.PE66

CP001977.PE66        Location/Qualifiers
FT   CDS             complement(67691..69229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3066"
FT                   /product="glycosyl hydrolase family 20, catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00728"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99673"
FT                   /db_xref="GOA:D4HEM4"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM4"
FT                   /protein_id="ADD99673.1"
FT                   /translation="MPTNDTLIRGLCPQPRQVQLTEGQFPLPSVLTWTGPDEVINAVTI
FT                   LTERLAPALDVVRATSHTDDASLTVIVDPALEAEGYRIDIDAQVRITVGSPSGARWAVQ
FT                   TLLQLLTPWVYGPGPLALKHLCLPKGVIVDAPHHSWRGAHLDVSRHFMPTSFIMNFLDV
FT                   LAVHKLNRLHLHLTDDQGWRLPVPGWPRLTTVGAWRPGTVRGHQPPPDDNGCDDVAEHD
FT                   HIPHGGAYTVDQLRAIDERAQLLGITVVPEVDLPGHTESVVAAYPELGCGAPISHPRTA
FT                   FGVSEHHINLTDAALGFCRDVLDAVMEIFPNSPIHIGGDECPGKEWFGHKPTRTRLAEL
FT                   GITTPHQAQAWFERQICGHVVAAGRQVIAWDEVLEAGAPEEVTVMVWRDADDIARAAAA
FT                   GHDVIAAPARHTYLDHGMETGPQAPVTIDAPMTMNDVAGLHDVLAAVNSPHLLGGQFQL
FT                   WTEYLCTPAQVEDAAFPRGTSIAEQLWTGNPARPLSELEAQTRRLTAMGVNWHR"
     MPTNDTLIRG LCPQPRQVQL TEGQFPLPSV LTWTGPDEVI NAVTILTERL APALDVVRAT        60
     SHTDDASLTV IVDPALEAEG YRIDIDAQVR ITVGSPSGAR WAVQTLLQLL TPWVYGPGPL       120
     ALKHLCLPKG VIVDAPHHSW RGAHLDVSRH FMPTSFIMNF LDVLAVHKLN RLHLHLTDDQ       180
     GWRLPVPGWP RLTTVGAWRP GTVRGHQPPP DDNGCDDVAE HDHIPHGGAY TVDQLRAIDE       240
     RAQLLGITVV PEVDLPGHTE SVVAAYPELG CGAPISHPRT AFGVSEHHIN LTDAALGFCR       300
     DVLDAVMEIF PNSPIHIGGD ECPGKEWFGH KPTRTRLAEL GITTPHQAQA WFERQICGHV       360
     VAAGRQVIAW DEVLEAGAPE EVTVMVWRDA DDIARAAAAG HDVIAAPARH TYLDHGMETG       420
     PQAPVTIDAP MTMNDVAGLH DVLAAVNSPH LLGGQFQLWT EYLCTPAQVE DAAFPRGTSI       480
     AEQLWTGNPA RPLSELEAQT RRLTAMGVNW HR                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page