(data stored in ACNUC30630 zone)

EMBL: CP001977.PE68

CP001977.PE68        Location/Qualifiers
FT   CDS             complement(70289..71659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3068"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00665"
FT                   /db_xref="GOA:D4HEM6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM6"
FT                   /protein_id="ADE00665.1"
FT                   /translation="MEDTGSQTLPTENRSTGSRGAGVRARLNRFNPSRNNVPQINIPGM
FT                   EEVLDPKLDDGRPADTERAWWGDVTLTLIMAVVTIAPYLVSLVEWPRPEYIAALLSSMV
FT                   MVASLPMRREHPLLMMTLVAIGAAIQFFFVPFPVLSIFVVPIASYSVARWVDGHQSRWV
FT                   LWVGAVGSVIGPMRWIPTIAAGYDPSSGTPWVLLVLAMTVCAGLVLTPYAVGRRLRESA
FT                   LIDSQQRIVKAQRYRAILAEREQQARVAEERTRNEIARELHDIVAHSLSVMIVQAEGGK
FT                   ALATKKPEKAPEVLETIAETGREALLEMRRIVGVLRQDTDAEFSPSPSLAEIPDLVDKS
FT                   GVKVELKVTGEEPVVSQALGLVIYRVVQEALTNVLKHAGPSAHATVTLAYSPTAIYVEI
FT                   LDDGYGAAVQGDGRGHGLQGMRERVTSMGGQLSAGPRKEGGFRVMAKLPVQADSRQR"
     MEDTGSQTLP TENRSTGSRG AGVRARLNRF NPSRNNVPQI NIPGMEEVLD PKLDDGRPAD        60
     TERAWWGDVT LTLIMAVVTI APYLVSLVEW PRPEYIAALL SSMVMVASLP MRREHPLLMM       120
     TLVAIGAAIQ FFFVPFPVLS IFVVPIASYS VARWVDGHQS RWVLWVGAVG SVIGPMRWIP       180
     TIAAGYDPSS GTPWVLLVLA MTVCAGLVLT PYAVGRRLRE SALIDSQQRI VKAQRYRAIL       240
     AEREQQARVA EERTRNEIAR ELHDIVAHSL SVMIVQAEGG KALATKKPEK APEVLETIAE       300
     TGREALLEMR RIVGVLRQDT DAEFSPSPSL AEIPDLVDKS GVKVELKVTG EEPVVSQALG       360
     LVIYRVVQEA LTNVLKHAGP SAHATVTLAY SPTAIYVEIL DDGYGAAVQG DGRGHGLQGM       420
     RERVTSMGGQ LSAGPRKEGG FRVMAKLPVQ ADSRQR                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page