(data stored in ACNUC30630 zone)

EMBL: CP001977.PE74

CP001977.PE74        Location/Qualifiers
FT   CDS             complement(80383..81144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3074"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01236"
FT                   /db_xref="GOA:D4HEN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN2"
FT                   /protein_id="ADE01236.1"
FT                   /translation="MDAMLTTTRPHPRAADTTIRGAHLRALGLTKTYGMTRALDHIDIA
FT                   IPAGQSVAVMGPSGSGKTTLLHCLSGILSPDSGSIELALPDRTVNVENLSNEGRAKLRR
FT                   QSLGFVFQQGMLVPELTAVENTALPLMLNGVSRTDAVRYATQWLESMGLGGMEDRRIGQ
FT                   LSGGQAQRVAIARSQVIDPSIVFADEPTGALDSATAVEVMAILLSATTGRGRTLVIVTH
FT                   DEDVARRCQRILHLHDGRIVSDDVRHSDGRW"
     MDAMLTTTRP HPRAADTTIR GAHLRALGLT KTYGMTRALD HIDIAIPAGQ SVAVMGPSGS        60
     GKTTLLHCLS GILSPDSGSI ELALPDRTVN VENLSNEGRA KLRRQSLGFV FQQGMLVPEL       120
     TAVENTALPL MLNGVSRTDA VRYATQWLES MGLGGMEDRR IGQLSGGQAQ RVAIARSQVI       180
     DPSIVFADEP TGALDSATAV EVMAILLSAT TGRGRTLVIV THDEDVARRC QRILHLHDGR       240
     IVSDDVRHSD GRW                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page