(data stored in ACNUC30630 zone)

EMBL: CP001977.PE83

CP001977.PE83        Location/Qualifiers
FT   CDS             complement(91112..91747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00663"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP1"
FT                   /protein_id="ADE00663.1"
FT                   /translation="MLAWVILADQVDSRRHNDEVPHLLAALTSPGLLVSPTGYTVGTPQ
FT                   WVLPPERTSGDEVQALTTDPASLIHAVWTSGSGPWRIGVSHGEVDTPLPDSTRAARGPA
FT                   YISAREAIDECRRRRAAIHVFADGTDGMRRFSQVAQVVVDLARRLRPAARDVAKFYDLS
FT                   MSSDETARALGISTSAVSQRLTRARWEYLVGIRQLAVDLAQEAQWPSP"
     MLAWVILADQ VDSRRHNDEV PHLLAALTSP GLLVSPTGYT VGTPQWVLPP ERTSGDEVQA        60
     LTTDPASLIH AVWTSGSGPW RIGVSHGEVD TPLPDSTRAA RGPAYISARE AIDECRRRRA       120
     AIHVFADGTD GMRRFSQVAQ VVVDLARRLR PAARDVAKFY DLSMSSDETA RALGISTSAV       180
     SQRLTRARWE YLVGIRQLAV DLAQEAQWPS P                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page