(data stored in ACNUC30630 zone)

EMBL: CP001977.PE91

CP001977.PE91        Location/Qualifiers
FT   CDS             100309..102498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99728"
FT                   /db_xref="GOA:D4HEP9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP9"
FT                   /protein_id="ADD99728.1"
FT                   /translation="MLAESWRLHYRSPAAEWEAYGLPIGNGRLGAVLRGDIARDVVQFN
FT                   ENSLWAESNNYDNGLCGVADDVFDTSMHGFGCYLDFGRVTISFADLDESTVSGYERALD
FT                   LRHAVAYACFDAGGVRHQRSAFASRETDVIVLRYSASAPFGCTVRLESAQGVPSRVAGD
FT                   TSVVFDGVLGNGLRYCASLVLLECDGRSIAHGDRIVVEDATTLALVLDAGTDYALSAVA
FT                   GWRGVNPRPVVDERICSATALGWERLHDAHVTKFSAVMDRCRLRWGRPVPELDAQPTDE
FT                   RLRRYRDGAADVGLEQLAVVLGRYLLVSSSRAEGLPANLQGLWNDSNDPAWGSDYHTNI
FT                   NVQMNYWGAEVTGLGEEHMALLNFVEEVAVPSRSATRAMCGPDVPGWTARTSQSPLGGN
FT                   GWQPNTVASAWYAHHVYEHWAFTRDDEWLRTRGLPMLAEICRFWEHQLVERDDGMIVAP
FT                   AGWSPEHGPREDGVAYDQQIVWDLFTNLLECSRALGVEDDLYYRVERLRDRLAPNQVGC
FT                   WGQLQEWQDDRDDPTELHRHTSHLFAVYPGRQITTDTPELQAAALVSLKARCGEPPPVA
FT                   GAPTVAPFRAEMVVGDSRRSWTWPWRAALFARLGDGYRAGEMVRGLLTYNMLPNLWTTH
FT                   PPFQVDGNLGLVGAVAEMLLPSHDGRIRLLPALPPAWEAEGEAIGLRARGGYRVSMQWR
FT                   DGQVIWFEIVADRGHAEDVIVVVNGREHRIRPDKR"
     MLAESWRLHY RSPAAEWEAY GLPIGNGRLG AVLRGDIARD VVQFNENSLW AESNNYDNGL        60
     CGVADDVFDT SMHGFGCYLD FGRVTISFAD LDESTVSGYE RALDLRHAVA YACFDAGGVR       120
     HQRSAFASRE TDVIVLRYSA SAPFGCTVRL ESAQGVPSRV AGDTSVVFDG VLGNGLRYCA       180
     SLVLLECDGR SIAHGDRIVV EDATTLALVL DAGTDYALSA VAGWRGVNPR PVVDERICSA       240
     TALGWERLHD AHVTKFSAVM DRCRLRWGRP VPELDAQPTD ERLRRYRDGA ADVGLEQLAV       300
     VLGRYLLVSS SRAEGLPANL QGLWNDSNDP AWGSDYHTNI NVQMNYWGAE VTGLGEEHMA       360
     LLNFVEEVAV PSRSATRAMC GPDVPGWTAR TSQSPLGGNG WQPNTVASAW YAHHVYEHWA       420
     FTRDDEWLRT RGLPMLAEIC RFWEHQLVER DDGMIVAPAG WSPEHGPRED GVAYDQQIVW       480
     DLFTNLLECS RALGVEDDLY YRVERLRDRL APNQVGCWGQ LQEWQDDRDD PTELHRHTSH       540
     LFAVYPGRQI TTDTPELQAA ALVSLKARCG EPPPVAGAPT VAPFRAEMVV GDSRRSWTWP       600
     WRAALFARLG DGYRAGEMVR GLLTYNMLPN LWTTHPPFQV DGNLGLVGAV AEMLLPSHDG       660
     RIRLLPALPP AWEAEGEAIG LRARGGYRVS MQWRDGQVIW FEIVADRGHA EDVIVVVNGR       720
     EHRIRPDKR                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page