(data stored in ACNUC30630 zone)

EMBL: CP001977.PSTS

CP001977.PSTS        Location/Qualifiers
FT   CDS             complement(413439..414590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="HMPREF0675_3383"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein PstS"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00975"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99326"
FT                   /db_xref="GOA:D4HAP2"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP2"
FT                   /protein_id="ADD99326.1"
FT                   /translation="MNRFAKITALAAISAISLTACGANGDKGSSSASSSKTTSTASSAA
FT                   QPSDSSADAVSFKPACPGGSISGAGSSAQLNAINQVISDYKAACSSATVNYSPTGSGAG
FT                   VKSFIGRQTDWAGSDSVLNADKGEPDKAKQRCNADPWHLPMAAGPIAVVYNVDGVKDLT
FT                   LSTATLAKIFSGAITNWNDDAIKKENPKAALPSAQIEVFYRKDESGTTDNFTKFLNKAA
FT                   GDIWTEKHSKTWKGAGKGADKSAGIAQAVKSTKNSISYDEWSYATKNSLDMAAIDNGNG
FT                   PVKLTGESAGKAVSAAKVVGQGHDLQLELQYKNTPAGVYPAVLVTYEIACSKGQDSGKA
FT                   ALLKDFLSFYASEREQKKIQDLGYAPLPSDVASKVLGSAQALS"
     MNRFAKITAL AAISAISLTA CGANGDKGSS SASSSKTTST ASSAAQPSDS SADAVSFKPA        60
     CPGGSISGAG SSAQLNAINQ VISDYKAACS SATVNYSPTG SGAGVKSFIG RQTDWAGSDS       120
     VLNADKGEPD KAKQRCNADP WHLPMAAGPI AVVYNVDGVK DLTLSTATLA KIFSGAITNW       180
     NDDAIKKENP KAALPSAQIE VFYRKDESGT TDNFTKFLNK AAGDIWTEKH SKTWKGAGKG       240
     ADKSAGIAQA VKSTKNSISY DEWSYATKNS LDMAAIDNGN GPVKLTGESA GKAVSAAKVV       300
     GQGHDLQLEL QYKNTPAGVY PAVLVTYEIA CSKGQDSGKA ALLKDFLSFY ASEREQKKIQ       360
     DLGYAPLPSD VASKVLGSAQ ALS                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page