(data stored in ACNUC30630 zone)

EMBL: CP001977.RADA

CP001977.RADA        Location/Qualifiers
FT   CDS             complement(384878..386275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0675_3354"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99549"
FT                   /db_xref="GOA:D4HAL4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL4"
FT                   /protein_id="ADD99549.1"
FT                   /translation="MARKTQTPTWVCTECGWTTTKWVGRCGECQTWGSVVEKGAPKLTE
FT                   VTSSTPTSKAVPIGQVSEQAANRHLTGISELDRVLGGGLVPGVVVLLAGEPGVGKSTLL
FT                   LDVAAKWAKAGRRTLYVTGEESAAQVRLRAGRTKSLADELYLASETDLGTVLGHIEQTE
FT                   PSLMVLDSVQTVGTSQADGSPGGVSQVREVTGALVRVAKRRGMAVIIVGHVTKEGSIAG
FT                   PRTMEHLVDVVLNFEGDRHSGFRMVRATKNRYGPADEVGCFEMTDAGIMEVPDPSGLFT
FT                   SDNADPQPGTCVTVTIEGRRPLLSEVQALVAPSASEKYPRRITHGVKGGRVAMILAVLE
FT                   RKAGLPLSNRDVYVSTVGGARVSDPSADLAIAVSVASAVLDTNFPTRVVALGEVGLAGD
FT                   LRRVPGLERRVGEAARLGFDLAVVPRNSREAHTKIPTMHGLHVIEVGSVAEALSVLNLR
FT                   RQRKVNQ"
     MARKTQTPTW VCTECGWTTT KWVGRCGECQ TWGSVVEKGA PKLTEVTSST PTSKAVPIGQ        60
     VSEQAANRHL TGISELDRVL GGGLVPGVVV LLAGEPGVGK STLLLDVAAK WAKAGRRTLY       120
     VTGEESAAQV RLRAGRTKSL ADELYLASET DLGTVLGHIE QTEPSLMVLD SVQTVGTSQA       180
     DGSPGGVSQV REVTGALVRV AKRRGMAVII VGHVTKEGSI AGPRTMEHLV DVVLNFEGDR       240
     HSGFRMVRAT KNRYGPADEV GCFEMTDAGI MEVPDPSGLF TSDNADPQPG TCVTVTIEGR       300
     RPLLSEVQAL VAPSASEKYP RRITHGVKGG RVAMILAVLE RKAGLPLSNR DVYVSTVGGA       360
     RVSDPSADLA IAVSVASAVL DTNFPTRVVA LGEVGLAGDL RRVPGLERRV GEAARLGFDL       420
     AVVPRNSREA HTKIPTMHGL HVIEVGSVAE ALSVLNLRRQ RKVNQ                       465
//

If you have problems or comments...

PBIL Back to PBIL home page