(data stored in ACNUC30630 zone)

EMBL: CP001977.THIG

CP001977.THIG        Location/Qualifiers
FT   CDS             complement(589883..590761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="HMPREF0675_3567"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00346"
FT                   /db_xref="GOA:D4HC33"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC33"
FT                   /protein_id="ADE00346.1"
FT                   /translation="MMTEETDVANVKETIVSCDEKAATSSDEPLRIGGLRLTSRLIMGT
FT                   GGSTSMDTLERALVASGTQLTTVAMRRFAAGPRQSVFEILQRHRITALPNTAGCYTARD
FT                   AILTANLAREALDTNLVKLEVIADEDTLLPDPVELVNAAEQLVANDFVVLAYTNDDPAI
FT                   AKRLEDLGCAAVMPAGAPIGTGLGILNPHNIELIVDRANVPVILDAGIGTASEATLAME
FT                   LGCDAVLLASAVTRAHNPVGMAQAMKMAVVAGRMARTSGRIPRRRLARASSPFDGIITG
FT                   RVRGPRENDSL"
     MMTEETDVAN VKETIVSCDE KAATSSDEPL RIGGLRLTSR LIMGTGGSTS MDTLERALVA        60
     SGTQLTTVAM RRFAAGPRQS VFEILQRHRI TALPNTAGCY TARDAILTAN LAREALDTNL       120
     VKLEVIADED TLLPDPVELV NAAEQLVAND FVVLAYTNDD PAIAKRLEDL GCAAVMPAGA       180
     PIGTGLGILN PHNIELIVDR ANVPVILDAG IGTASEATLA MELGCDAVLL ASAVTRAHNP       240
     VGMAQAMKMA VVAGRMARTS GRIPRRRLAR ASSPFDGIIT GRVRGPREND SL               292
//

If you have problems or comments...

PBIL Back to PBIL home page