(data stored in ACNUC30630 zone)

EMBL: CP001977.XSEB

CP001977.XSEB        Location/Qualifiers
FT   CDS             complement(646434..646670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="HMPREF0675_3628"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00962"
FT                   /db_xref="GOA:D4HC86"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC86"
FT                   /protein_id="ADE00962.1"
FT                   /translation="MTDTTPNSAPEEPEITYEAARDELVEIVTRLESGGISLAETMTLW
FT                   ERGEKLADICQSWLNGARARIEAARSDAETAQP"
     MTDTTPNSAP EEPEITYEAA RDELVEIVTR LESGGISLAE TMTLWERGEK LADICQSWLN        60
     GARARIEAAR SDAETAQP                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page