(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE100

CP001994.PE100       Location/Qualifiers
FT   CDS             107795..108541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0102"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35638"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X9"
FT                   /protein_id="ADE35638.1"
FT                   /translation="MSSYEKMSEIINFSLDELYAITRYLHEKEDVDNPTTVLIGGWAVD
FT                   SYNSWYGSVDIDLITNNSTRNSLNYYLRKERNFVPYRLPGQPRSVRKETRAGSVIIDFA
FT                   TREKPFPFEGTDEYLDFSILDGNTESRAIRGNIEMAVPNRATLIVLKLKAIWDRNNRIS
FT                   HGNSHDIEWESGKLVKDYADILALIDPNSGGKDVEISILGKLMNTYPFLKESLASVGES
FT                   DDGIEKYGRMSESTAKRIIGQMLSLI"
     MSSYEKMSEI INFSLDELYA ITRYLHEKED VDNPTTVLIG GWAVDSYNSW YGSVDIDLIT        60
     NNSTRNSLNY YLRKERNFVP YRLPGQPRSV RKETRAGSVI IDFATREKPF PFEGTDEYLD       120
     FSILDGNTES RAIRGNIEMA VPNRATLIVL KLKAIWDRNN RISHGNSHDI EWESGKLVKD       180
     YADILALIDP NSGGKDVEIS ILGKLMNTYP FLKESLASVG ESDDGIEKYG RMSESTAKRI       240
     IGQMLSLI                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page