(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE103

CP001994.PE103       Location/Qualifiers
FT   CDS             complement(109595..120376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0105"
FT                   /product="conserved repeat domain protein"
FT                   /note="InterPro IPR002931:IPR016160:IPR001434; KEGG:
FT                   geo:Geob_3466 transglutaminase domain protein; PFAM:
FT                   transglutaminase domain protein; SMART: transglutaminase
FT                   domain protein; SPTR: B6KF59 Putative uncharacterized
FT                   protein; TIGRFAM: conserved repeat domain protein; PFAM:
FT                   Transglutaminase-like superfamily; TIGRFAM: conserved
FT                   repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35641"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y2"
FT                   /protein_id="ADE35641.1"
FT                   /translation="MKDTTKIISIILICIMITASFAGAAPSVVDNETHFDPLEKTDENP
FT                   KLKLMHRSIDYDAAPLSSSYITPSYESQNNPPSESDLDLRFAADASIDILDSAEKNQYD
FT                   PGLIYSFVHNYFEYIPYFGSLKGAHLTYQDREGNDADLASLTISLLRASDIPARYVYGT
FT                   IELDNNQAMNYFGVENESVIVDMLRKNGISAQAVSGGIQFDHVWVEAYVDGQWVEFDPS
FT                   FKQYNYTPGVDLMALARDSENYNSMLDDNIETSGDEVTSINVSGIDSSFTLMSNNFSTL
FT                   LNEEYANKSNSEIFGAKEIIPHTDYYTLPEQLPYKVVGVHGEYPNLPDSFNHKLDIKLA
FT                   GINVTLNTTELAGKRISVFYEPSTEKDSDLLNSSDNLSEVNALDINMSALLQVDGALIA
FT                   AGQPSTLGSEQELEIGFIAPGGQIDAYTRTLQTGAYFVIGLALQPVSTAHMSERVERYE
FT                   VTSELLDLEYFDVTKDELYGELLNLQALTFWGKYRLYNSIAAASTDVTYTRHPSVMLVG
FT                   TQFNVTETNDTRSVHMNGVYTDIVRDIINPTAKDGDSAKSYAFLFSRGMTASSMEKSML
FT                   SLSYNVTAYSTSEIIKIAGENGIPILTLNSSNWDNAGSNLNISKNDKTIVENAVDSGYT
FT                   VIIPRDEVVAGNFTGSVFIVFDPQTGASSYYGPNGKGWGWLDTLKTGLEAGVSAVGSVA
FT                   KGTAKVIADTGGKVAGVATGVISTVGEAVTGTGSTVARVAKTAVTGAVNAAGYVVTTVV
FT                   PTAAAGVTAATTAGLVVVTAFTADRVTELGKTVIDVYDAKADYEKSVKEYRQTQEEIKE
FT                   KKEQIKKEELEQKREELKEKKKELEEKKEKVEEEEEIDLDKEKEEKEDKEDEVDEEEKE
FT                   DEDDFPGDEEKPDEIELEDEIELDDLPEPEDDPIEPSSPGGDHPDDTFSVASSKLRNTD
FT                   VTSLQIRNAYKKGYTNPVYLNEYRLGQLERANVSNYTDTAELNKLYELSNSQADVYSTI
FT                   VNNYTAIKEELELAPDVLMLQKGFYASAQAMVENRGIPVKLTRVQDFAVADTQQLVHDT
FT                   PILFLPSGSLYGLDSSTQIQNKLEEYAATGGTVFVMAQQHGYEYSILPHNGTRALGGAG
FT                   WQEDQSCLYNAASIGTYHPAVSGQPKPTLTVNIDGYFTSYPENTTIILKRNKNSMPAML
FT                   AYDYYNGTVIATSVYDDWAYFDGASTLQGELLVRDVLAWAENPANVEAMLETDSIDTPV
FT                   NITNKGDFAATQVIFKFTDPLGNTEVENTIDLDPELEPGASKQINFSYKPKTGSTLGVW
FT                   NLDYILVNESDTAYTEYDARKMAIGKYVASDQGYSTTPDITYSIRSTNDRFAYGSDAVF
FT                   TVTVWNNGDTDQNVTLNYCFPHHGWIEYDLAYGIAKDRSWYNLEKTLEVPAQGSTSFNH
FT                   KLENVRTFDRLWSRLYDTDGNKIGSATLGLYCFSPKLDIEFDSGDIFKTKSNNTLNYTI
FT                   MRSTGDIPNASIDVKIYDSKSNLVKRETTTSNITATSVYNGSIEFSPQNKGSYNFVVEV
FT                   TNNGKLIGTNSQYILAKDRVLNLIVAQEPDFSFYETNNFSIDIENMEITNFSDLVLETS
FT                   YINPDGDINYSDTTTFDIESETTKNLNVSIPFDRVATGVHKTTFKLLEDAEVVDKKESS
FT                   FVYSPTLWTHLSSTTLVRDTEETLTVYVNNGDAAAELIVDISSDMGFQNQSSILFEAGE
FT                   RKNIEYTIPVESDVSAGSIMVELRANGSSKQNSPLKTSSISYTGGDSKLMPTLQANIVA
FT                   GNNLTFSITNEGPADTSMSYSYYFLGHSDKDEIDIAANETLSHEIPVPMISSGDYNFRL
FT                   NLQNLGTDRTTRQLIPVHVQGLDLDMSMEEEELEADMYIPVKLNNSGIEITVNLEAQLT
FT                   RGYEKTVLTAENVTIGAGEVKVVELPLDPSLSSGAYSLHLSYENSSYNVRSDKYYNPKI
FT                   EGLGLDFDVAKKEYAAGDTLDLTIDNTGAIDTRSNVTVRLGNNDLGTQQAAVDVGEQSV
FT                   LTYTLPENLPTATFGLFVNCEEANSGGVLTFSKSIPVSGLEYSLELQPQTVKPGQNLTA
FT                   SVSNTGTIALSGNYDLSIYDGYTLIEGSSGQVSAIAPGETELLELEVPSTIDSGTYTFI
FT                   FELTDQLDSTDSKTVSVYIPDASFEMTLDDAEYLQGGSIGVTANISNIENGSFTMSLFD
FT                   GQDNTIATSPPEEHNASSGSVNLTFSIPEGIMSGPYVLFVEVKDQASGLSNSTSQSLAI
FT                   EGINIEPHIETANTKYLEGDTIDYEVRLNHSGTLPQGDAYIKAYLQEDMGSSGEFTLES
FT                   KYPATGFERFGDTLFIGTSGGLYTETGFAEMQPVENSELAAMEISGLDVDGNLLWILSD
FT                   NTVYNYDPVSDMLDEVLVVEKQEDEGHQEGGSSLFAVDSSEQVIYMPNGWEGLAAYGFD
FT                   GSVTYYTSENSPLGEVTDILVLPDEVLFVDYDYTNDSSSCHSLSDGIWSTYDSSDGLLS
FT                   DNVYSAVSDGNNVYFITDAGISSRDVSGGAIGTEYEFGTGESVSGVDAAGVFDGIVYFV
FT                   SYSDLYRYDSSESTLNVSTIFDNWLQMSDLGVGNSALWFCDYWNGLFTSDKTASEIGDV
FT                   SEVPIPDTFSPDGTITGDSDVIVSADGKSVYIYDIASQVWNRMEVPVELGVSDVTFMAD
FT                   HIWIASDADLIGIDKNTGDISIFNESNSDYNESSVSLIENHKGDIWVLGGGGVSVYSIS
FT                   DGLSTASINSPDISDPEDITAFEEIVAVINSSGTIHEYNYMSDNVRTYETGITDWNGLE
FT                   LEYNQDIYWVLKTGGSELYSYNPATEETSGPEESTGSTYGLATAGEKLYAVADWLYIFD
FT                   GQTWNEYTGDLIPEDSDIGIESAGENVLLYAEYGDGWITSLSGQGRQLVMDRTVQFADF
FT                   STEGTWQNTYIPDRSGQLTFEVEAVTDLKQITDQAKLSVDVYERDVSVALSTAKEYYRP
FT                   DEPINATVRVSNNAPATFESELVSSINKDEIGREDLVIESGDSLKFEIPVSNLPVGDHT
FT                   LRVRVGDAGVSRDIVVANPEIEVSMNVPEVVSSNPFTVELFANNPGNVTAKTGVTVTNL
FT                   SIEEEFDLILAPGTSQYLALNTTIANNTTVVAEFTGDIDTRLTEDMEFGERAHIDTQCQ
FT                   TIYRPGTVEIPVNVTNTGQYKTDFNVSFSVNDTTSLHKSYILGINQSVDDVLAFDLAAG
FT                   DYNLSADATGQIPVEFEKVAFQVGQTTGFELGKAEVVSGNLSFMVNLSNKQPGIAFNGT
FT                   VEIITDFYESTEQVNLSALENTSIGHNISLPELTPGNYTLQAQLLESQEVIQIANSTFT
FT                   IQAPEFTVAPSLNKQNVQPGEILKYNFTVSNTGSIGAMADMYLDVPGVYEDTLTSWIAS
FT                   EDSHNFSFSFKAPDDLAEGYYPLYYGLEEDNLTESRFYLEGANVTVNSWLDKRAYLPGE
FT                   NATLTMQVENNGNYPLELYSRVKYFDFDDVHEFTVDKNSTTTFTVDIPTPQTDNKVFIS
FT                   VYLDSPEGDEDSGRSLYINSDYIHDRRDVNGLRISTERQAYETGETVVMNVNVTRADNL
FT                   TVVGPGLDYNGYIAVNTTIDFEVPNVLSGVYRYEITYGDATGQYLLDIHGFDLIVKAAQ
FT                   VGPGRGGE"
     MKDTTKIISI ILICIMITAS FAGAAPSVVD NETHFDPLEK TDENPKLKLM HRSIDYDAAP        60
     LSSSYITPSY ESQNNPPSES DLDLRFAADA SIDILDSAEK NQYDPGLIYS FVHNYFEYIP       120
     YFGSLKGAHL TYQDREGNDA DLASLTISLL RASDIPARYV YGTIELDNNQ AMNYFGVENE       180
     SVIVDMLRKN GISAQAVSGG IQFDHVWVEA YVDGQWVEFD PSFKQYNYTP GVDLMALARD       240
     SENYNSMLDD NIETSGDEVT SINVSGIDSS FTLMSNNFST LLNEEYANKS NSEIFGAKEI       300
     IPHTDYYTLP EQLPYKVVGV HGEYPNLPDS FNHKLDIKLA GINVTLNTTE LAGKRISVFY       360
     EPSTEKDSDL LNSSDNLSEV NALDINMSAL LQVDGALIAA GQPSTLGSEQ ELEIGFIAPG       420
     GQIDAYTRTL QTGAYFVIGL ALQPVSTAHM SERVERYEVT SELLDLEYFD VTKDELYGEL       480
     LNLQALTFWG KYRLYNSIAA ASTDVTYTRH PSVMLVGTQF NVTETNDTRS VHMNGVYTDI       540
     VRDIINPTAK DGDSAKSYAF LFSRGMTASS MEKSMLSLSY NVTAYSTSEI IKIAGENGIP       600
     ILTLNSSNWD NAGSNLNISK NDKTIVENAV DSGYTVIIPR DEVVAGNFTG SVFIVFDPQT       660
     GASSYYGPNG KGWGWLDTLK TGLEAGVSAV GSVAKGTAKV IADTGGKVAG VATGVISTVG       720
     EAVTGTGSTV ARVAKTAVTG AVNAAGYVVT TVVPTAAAGV TAATTAGLVV VTAFTADRVT       780
     ELGKTVIDVY DAKADYEKSV KEYRQTQEEI KEKKEQIKKE ELEQKREELK EKKKELEEKK       840
     EKVEEEEEID LDKEKEEKED KEDEVDEEEK EDEDDFPGDE EKPDEIELED EIELDDLPEP       900
     EDDPIEPSSP GGDHPDDTFS VASSKLRNTD VTSLQIRNAY KKGYTNPVYL NEYRLGQLER       960
     ANVSNYTDTA ELNKLYELSN SQADVYSTIV NNYTAIKEEL ELAPDVLMLQ KGFYASAQAM      1020
     VENRGIPVKL TRVQDFAVAD TQQLVHDTPI LFLPSGSLYG LDSSTQIQNK LEEYAATGGT      1080
     VFVMAQQHGY EYSILPHNGT RALGGAGWQE DQSCLYNAAS IGTYHPAVSG QPKPTLTVNI      1140
     DGYFTSYPEN TTIILKRNKN SMPAMLAYDY YNGTVIATSV YDDWAYFDGA STLQGELLVR      1200
     DVLAWAENPA NVEAMLETDS IDTPVNITNK GDFAATQVIF KFTDPLGNTE VENTIDLDPE      1260
     LEPGASKQIN FSYKPKTGST LGVWNLDYIL VNESDTAYTE YDARKMAIGK YVASDQGYST      1320
     TPDITYSIRS TNDRFAYGSD AVFTVTVWNN GDTDQNVTLN YCFPHHGWIE YDLAYGIAKD      1380
     RSWYNLEKTL EVPAQGSTSF NHKLENVRTF DRLWSRLYDT DGNKIGSATL GLYCFSPKLD      1440
     IEFDSGDIFK TKSNNTLNYT IMRSTGDIPN ASIDVKIYDS KSNLVKRETT TSNITATSVY      1500
     NGSIEFSPQN KGSYNFVVEV TNNGKLIGTN SQYILAKDRV LNLIVAQEPD FSFYETNNFS      1560
     IDIENMEITN FSDLVLETSY INPDGDINYS DTTTFDIESE TTKNLNVSIP FDRVATGVHK      1620
     TTFKLLEDAE VVDKKESSFV YSPTLWTHLS STTLVRDTEE TLTVYVNNGD AAAELIVDIS      1680
     SDMGFQNQSS ILFEAGERKN IEYTIPVESD VSAGSIMVEL RANGSSKQNS PLKTSSISYT      1740
     GGDSKLMPTL QANIVAGNNL TFSITNEGPA DTSMSYSYYF LGHSDKDEID IAANETLSHE      1800
     IPVPMISSGD YNFRLNLQNL GTDRTTRQLI PVHVQGLDLD MSMEEEELEA DMYIPVKLNN      1860
     SGIEITVNLE AQLTRGYEKT VLTAENVTIG AGEVKVVELP LDPSLSSGAY SLHLSYENSS      1920
     YNVRSDKYYN PKIEGLGLDF DVAKKEYAAG DTLDLTIDNT GAIDTRSNVT VRLGNNDLGT      1980
     QQAAVDVGEQ SVLTYTLPEN LPTATFGLFV NCEEANSGGV LTFSKSIPVS GLEYSLELQP      2040
     QTVKPGQNLT ASVSNTGTIA LSGNYDLSIY DGYTLIEGSS GQVSAIAPGE TELLELEVPS      2100
     TIDSGTYTFI FELTDQLDST DSKTVSVYIP DASFEMTLDD AEYLQGGSIG VTANISNIEN      2160
     GSFTMSLFDG QDNTIATSPP EEHNASSGSV NLTFSIPEGI MSGPYVLFVE VKDQASGLSN      2220
     STSQSLAIEG INIEPHIETA NTKYLEGDTI DYEVRLNHSG TLPQGDAYIK AYLQEDMGSS      2280
     GEFTLESKYP ATGFERFGDT LFIGTSGGLY TETGFAEMQP VENSELAAME ISGLDVDGNL      2340
     LWILSDNTVY NYDPVSDMLD EVLVVEKQED EGHQEGGSSL FAVDSSEQVI YMPNGWEGLA      2400
     AYGFDGSVTY YTSENSPLGE VTDILVLPDE VLFVDYDYTN DSSSCHSLSD GIWSTYDSSD      2460
     GLLSDNVYSA VSDGNNVYFI TDAGISSRDV SGGAIGTEYE FGTGESVSGV DAAGVFDGIV      2520
     YFVSYSDLYR YDSSESTLNV STIFDNWLQM SDLGVGNSAL WFCDYWNGLF TSDKTASEIG      2580
     DVSEVPIPDT FSPDGTITGD SDVIVSADGK SVYIYDIASQ VWNRMEVPVE LGVSDVTFMA      2640
     DHIWIASDAD LIGIDKNTGD ISIFNESNSD YNESSVSLIE NHKGDIWVLG GGGVSVYSIS      2700
     DGLSTASINS PDISDPEDIT AFEEIVAVIN SSGTIHEYNY MSDNVRTYET GITDWNGLEL      2760
     EYNQDIYWVL KTGGSELYSY NPATEETSGP EESTGSTYGL ATAGEKLYAV ADWLYIFDGQ      2820
     TWNEYTGDLI PEDSDIGIES AGENVLLYAE YGDGWITSLS GQGRQLVMDR TVQFADFSTE      2880
     GTWQNTYIPD RSGQLTFEVE AVTDLKQITD QAKLSVDVYE RDVSVALSTA KEYYRPDEPI      2940
     NATVRVSNNA PATFESELVS SINKDEIGRE DLVIESGDSL KFEIPVSNLP VGDHTLRVRV      3000
     GDAGVSRDIV VANPEIEVSM NVPEVVSSNP FTVELFANNP GNVTAKTGVT VTNLSIEEEF      3060
     DLILAPGTSQ YLALNTTIAN NTTVVAEFTG DIDTRLTEDM EFGERAHIDT QCQTIYRPGT      3120
     VEIPVNVTNT GQYKTDFNVS FSVNDTTSLH KSYILGINQS VDDVLAFDLA AGDYNLSADA      3180
     TGQIPVEFEK VAFQVGQTTG FELGKAEVVS GNLSFMVNLS NKQPGIAFNG TVEIITDFYE      3240
     STEQVNLSAL ENTSIGHNIS LPELTPGNYT LQAQLLESQE VIQIANSTFT IQAPEFTVAP      3300
     SLNKQNVQPG EILKYNFTVS NTGSIGAMAD MYLDVPGVYE DTLTSWIASE DSHNFSFSFK      3360
     APDDLAEGYY PLYYGLEEDN LTESRFYLEG ANVTVNSWLD KRAYLPGENA TLTMQVENNG      3420
     NYPLELYSRV KYFDFDDVHE FTVDKNSTTT FTVDIPTPQT DNKVFISVYL DSPEGDEDSG      3480
     RSLYINSDYI HDRRDVNGLR ISTERQAYET GETVVMNVNV TRADNLTVVG PGLDYNGYIA      3540
     VNTTIDFEVP NVLSGVYRYE ITYGDATGQY LLDIHGFDLI VKAAQVGPGR GGE             3593
//

If you have problems or comments...

PBIL Back to PBIL home page