(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE113

CP001994.PE113       Location/Qualifiers
FT   CDS             144609..145445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0115"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675; KEGG: pag:PLES_55221
FT                   hypothetical protein; PFAM: Abortive infection protein;
FT                   SPTR: Q12UI9 Abortive infection protein; PFAM: CAAX amino
FT                   terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35651"
FT                   /db_xref="GOA:D5E900"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5E900"
FT                   /protein_id="ADE35651.1"
FT                   /translation="MSESHPFKSMDLPGLSGVQLNRNSAVILVPVLLIMLAEMLLFVEM
FT                   DYLSICIHVALLLGLPLAAIFFDNREITMAFQALMLLPLLRLVNISMPIFFETTLYVFV
FT                   FIYAPLIIPVYLVAKEQDFTLSLRGFRDVNRMWLVYIFLAILVAILIAQGEYAILASNY
FT                   LIPDLSFISLLKISLVMVFFVGFIEELIFRFILQTRLADTFGVWPGLIIASLLFGVMHS
FT                   GYGAPLEVLMTAFAGLILGYMFLRTKSISFVSFTHGFVNVFLFGVIPHLGPGLGLF"
     MSESHPFKSM DLPGLSGVQL NRNSAVILVP VLLIMLAEML LFVEMDYLSI CIHVALLLGL        60
     PLAAIFFDNR EITMAFQALM LLPLLRLVNI SMPIFFETTL YVFVFIYAPL IIPVYLVAKE       120
     QDFTLSLRGF RDVNRMWLVY IFLAILVAIL IAQGEYAILA SNYLIPDLSF ISLLKISLVM       180
     VFFVGFIEEL IFRFILQTRL ADTFGVWPGL IIASLLFGVM HSGYGAPLEV LMTAFAGLIL       240
     GYMFLRTKSI SFVSFTHGFV NVFLFGVIPH LGPGLGLF                               278
//

If you have problems or comments...

PBIL Back to PBIL home page