(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE12

CP001994.PE12        Location/Qualifiers
FT   CDS             complement(11913..12953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0012"
FT                   /product="elongation factor Tu domain 2 protein"
FT                   /note="COGs: COG3276 Selenocysteine-specific translation
FT                   elongation factor; InterPro IPR004161; KEGG: dar:Daro_1810
FT                   selenocysteine-specific translation elongation factor SelB;
FT                   PFAM: elongation factor Tu domain 2 protein; SPTR: Q12V79
FT                   Elongation factor Tu, domain 2; PFAM: Elongation factor Tu
FT                   domain 2; Elongation factor Tu GTP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35550"
FT                   /db_xref="GOA:D5E8P1"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P1"
FT                   /protein_id="ADE35550.1"
FT                   /translation="MTKIAIIGSEGSGRTSLAAKLGKKSTAADITMYDYAKNDVVMTTI
FT                   DANGYPKSVKPLVTALQLSDIALLCIPPEGPDAFAGECIMALDLMQYKHGIVVLTKADT
FT                   SYPYAQEELQKNLQKILSPTTLANWEFVNLSTESFEGLDEIKEKIFELDEQVNSEYEEL
FT                   NDKPVRIIVDQSFNVTGIGCVVLGIVKQGTVNAKEKLTAYPADKPLEVRSIQMHDEDVK
FT                   SAPAGARVGLALKGVQSKDIERGFIISEKEEVAESLVLECTLSSFASPLKLSDVPHIFT
FT                   GLQSSPMRIEKIEIDGKEAEQVNASQQCTLHLNGSHEIAYRQQDRFIITNLDAKQRFTG
FT                   YGFVKE"
     MTKIAIIGSE GSGRTSLAAK LGKKSTAADI TMYDYAKNDV VMTTIDANGY PKSVKPLVTA        60
     LQLSDIALLC IPPEGPDAFA GECIMALDLM QYKHGIVVLT KADTSYPYAQ EELQKNLQKI       120
     LSPTTLANWE FVNLSTESFE GLDEIKEKIF ELDEQVNSEY EELNDKPVRI IVDQSFNVTG       180
     IGCVVLGIVK QGTVNAKEKL TAYPADKPLE VRSIQMHDED VKSAPAGARV GLALKGVQSK       240
     DIERGFIISE KEEVAESLVL ECTLSSFASP LKLSDVPHIF TGLQSSPMRI EKIEIDGKEA       300
     EQVNASQQCT LHLNGSHEIA YRQQDRFIIT NLDAKQRFTG YGFVKE                      346
//

If you have problems or comments...

PBIL Back to PBIL home page