(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE120

CP001994.PE120       Location/Qualifiers
FT   CDS             complement(151824..152951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0122"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   cps:CPS_5020 glycosyl transferase, group 2 family protein;
FT                   PFAM: glycosyl transferase family 2; SPTR: Q12VL4 Glycosyl
FT                   transferase, family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35658"
FT                   /db_xref="GOA:D5E907"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E907"
FT                   /protein_id="ADE35658.1"
FT                   /translation="MNYLLIAAVLFTLIPVITYLIYILAILKPSSSKIHTPDTQPPITV
FT                   VIPTYNESEVIEHRIKNLKDIDYPTENIHVIVVDDQSTDNTVGLAAEAFKKYDLSGEVI
FT                   VKEKRTGTNASVNMGVGEATTDFVVTTDADVTFEPDAVNNALGRLLSDEKIGAVCGELE
FT                   PIARQDSFTTHSEKAYRDVYGRMCSWESCLHSTYCFNGPLIVMRKKAFSPIPETKGASD
FT                   AGMALRIIRNGYRCLYESSARFYEYITSDMDQQRRQKLRRSARLQEATLHNLGLVSPEY
FT                   GKFGLFVLPLRFVMFFIAPVSFFLAVILWSVVLGSINLIWGIGVLVLFGLALLSGQWKS
FT                   NLISSFIWHQIYLLVSLVYMSRGVHVWQAIERKKV"
     MNYLLIAAVL FTLIPVITYL IYILAILKPS SSKIHTPDTQ PPITVVIPTY NESEVIEHRI        60
     KNLKDIDYPT ENIHVIVVDD QSTDNTVGLA AEAFKKYDLS GEVIVKEKRT GTNASVNMGV       120
     GEATTDFVVT TDADVTFEPD AVNNALGRLL SDEKIGAVCG ELEPIARQDS FTTHSEKAYR       180
     DVYGRMCSWE SCLHSTYCFN GPLIVMRKKA FSPIPETKGA SDAGMALRII RNGYRCLYES       240
     SARFYEYITS DMDQQRRQKL RRSARLQEAT LHNLGLVSPE YGKFGLFVLP LRFVMFFIAP       300
     VSFFLAVILW SVVLGSINLI WGIGVLVLFG LALLSGQWKS NLISSFIWHQ IYLLVSLVYM       360
     SRGVHVWQAI ERKKV                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page