(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE128

CP001994.PE128       Location/Qualifiers
FT   CDS             complement(159782..160486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0131"
FT                   /product="uridylate kinase"
FT                   /note="COGs: COG0528 Uridylate kinase; InterPro
FT                   IPR001048:IPR011818; KEGG: sfu:Sfum_1780 uridylate kinase;
FT                   PFAM: aspartate/glutamate/uridylate kinase; SPTR: Q12VQ2
FT                   Uridylate kinase; TIGRFAM: uridylate kinase; PFAM: Amino
FT                   acid kinase family; TIGRFAM: uridylate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35666"
FT                   /db_xref="GOA:D5E915"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5E915"
FT                   /protein_id="ADE35666.1"
FT                   /translation="MLVVISIGGSILARDLDPERFAKYADMLEELSKEHSVVVVTGGGV
FT                   AARQYIEAARQVGANEVTCDFIGIDVTRLNAQLLIAALGKNAYPEPPQSYRDAELALSS
FT                   GKIIVMGGVIPGQTTDTVSAVLAEYLGAELMVIATSVDGVYSKDPTTSNDAEKFDVMSP
FT                   KELLDVVMSTEMKAGSKSPVDPLAAKIIERCNIETIVMDGSSEGDIYKVVMQEKIKSEP
FT                   VEGERVGTRIKS"
     MLVVISIGGS ILARDLDPER FAKYADMLEE LSKEHSVVVV TGGGVAARQY IEAARQVGAN        60
     EVTCDFIGID VTRLNAQLLI AALGKNAYPE PPQSYRDAEL ALSSGKIIVM GGVIPGQTTD       120
     TVSAVLAEYL GAELMVIATS VDGVYSKDPT TSNDAEKFDV MSPKELLDVV MSTEMKAGSK       180
     SPVDPLAAKI IERCNIETIV MDGSSEGDIY KVVMQEKIKS EPVEGERVGT RIKS             234
//

If you have problems or comments...

PBIL Back to PBIL home page