(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE130

CP001994.PE130       Location/Qualifiers
FT   CDS             161171..161716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0133"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013373; SPTR: B0R6S7 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1628); TIGRFAM: archaeal flagellin N-terminal-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35668"
FT                   /db_xref="GOA:D5E917"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D5E917"
FT                   /protein_id="ADE35668.1"
FT                   /translation="MKDENGISPVVGILLMIAITIVLGVSLAFFAIGFEMQEPAPFVAH
FT                   SSGELVRKGDTDVDFGDQRVYIYHEGGDAVKMSEVETMVDATEVSGMKARIVNLPVSKT
FT                   ESLGNHILGDDGLIDKSAPNFEKCGGAITKEYFSVGEKLWFRINSGECPLEKGDQITVK
FT                   IIHTPTNTIVIEETLTAS"
     MKDENGISPV VGILLMIAIT IVLGVSLAFF AIGFEMQEPA PFVAHSSGEL VRKGDTDVDF        60
     GDQRVYIYHE GGDAVKMSEV ETMVDATEVS GMKARIVNLP VSKTESLGNH ILGDDGLIDK       120
     SAPNFEKCGG AITKEYFSVG EKLWFRINSG ECPLEKGDQI TVKIIHTPTN TIVIEETLTA       180
     S                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page