(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE136

CP001994.PE136       Location/Qualifiers
FT   CDS             166860..167279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0139"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763; KEGG: gem:GM21_3931 rhodanese domain
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; SPTR: Q12VR2 Rhodanese-like protein; PFAM:
FT                   Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35674"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5E923"
FT                   /protein_id="ADE35674.1"
FT                   /translation="MSKNTIVVLICVLGTLALGGCVQQEDDNTASQLENCEYSDVSAEE
FT                   ALNLIEEQDVFILDVRTRSEYDAGHLEDSYLIPVSELKNRLDEVPRDTAILVYCRSGRR
FT                   SVTASNILLDAGYCDVYNMEAGFNEWRSAGYPYMG"
     MSKNTIVVLI CVLGTLALGG CVQQEDDNTA SQLENCEYSD VSAEEALNLI EEQDVFILDV        60
     RTRSEYDAGH LEDSYLIPVS ELKNRLDEVP RDTAILVYCR SGRRSVTASN ILLDAGYCDV       120
     YNMEAGFNEW RSAGYPYMG                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page