(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE141

CP001994.PE141       Location/Qualifiers
FT   CDS             complement(172602..173012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0144"
FT                   /product="Threonyl-tRNA synthetase editing domain protein"
FT                   /note="InterPro IPR015011; KEGG: sfu:Sfum_0182 hypothetical
FT                   protein; PFAM: Threonyl-tRNA synthetase editing domain
FT                   protein; SPTR: A7I9Y6 Putative uncharacterized protein;
FT                   PFAM: Archaea-specific editing domain of threonyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35679"
FT                   /db_xref="GOA:D5E928"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D5E928"
FT                   /protein_id="ADE35679.1"
FT                   /translation="MKMLLFDTEYFWFDTFSKTLENVEDIKKEEKIENTAVVFIHVELE
FT                   DEERKNKVVKNAVKTFKWYLNKVDKEKIVLHSFAHLSSSTSSPEFAAEIISEIKEKLIN
FT                   KGIEVHTTPFGYFSEFSIHVRGESLAKIFKEI"
     MKMLLFDTEY FWFDTFSKTL ENVEDIKKEE KIENTAVVFI HVELEDEERK NKVVKNAVKT        60
     FKWYLNKVDK EKIVLHSFAH LSSSTSSPEF AAEIISEIKE KLINKGIEVH TTPFGYFSEF       120
     SIHVRGESLA KIFKEI                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page