(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE144

CP001994.PE144       Location/Qualifiers
FT   CDS             176362..176694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0147"
FT                   /product="Protein of unknown function CGGC region"
FT                   /note="InterPro IPR014925; KEGG: dds:Ddes_0610 protein of
FT                   unknown function CGGC region; PFAM: Protein of unknown
FT                   function CGGC region; SPTR: Q12Z01 Putative uncharacterized
FT                   protein; PFAM: CGGC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35682"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:D5E931"
FT                   /protein_id="ADE35682.1"
FT                   /translation="MKVGLIRCMQTEDMCPATTDFKVMREKKLAFKDVEGEIEVIGVVS
FT                   CGGCPGKKAATRAAEMVRRGADTIALASCITKGNPIGFACPHAEQMKAAIRKKIGDSIQ
FT                   LIDYTH"
     MKVGLIRCMQ TEDMCPATTD FKVMREKKLA FKDVEGEIEV IGVVSCGGCP GKKAATRAAE        60
     MVRRGADTIA LASCITKGNP IGFACPHAEQ MKAAIRKKIG DSIQLIDYTH                  110
//

If you have problems or comments...

PBIL Back to PBIL home page