(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE146

CP001994.PE146       Location/Qualifiers
FT   CDS             complement(177050..177706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0149"
FT                   /product="Protein of unknown function DUF2284,
FT                   metal-binding protein"
FT                   /note="COGs: COG5423 metal-binding protein; InterPro
FT                   IPR019271; KEGG: ppd:Ppro_0073 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2284, metal-binding; SPTR:
FT                   Q467J8 Putative uncharacterized protein; PFAM: Predicted
FT                   metal-binding protein (DUF2284)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35684"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:D5E933"
FT                   /protein_id="ADE35684.1"
FT                   /translation="MTIPEENYRILKQTGGELGAKSVRLIPAENIIIENRTILKCIFGC
FT                   NGYGSQVCPPFIPTVDEFRQMLMEYQWALLVDWKSDNRFSREISENFIKYSVTSPDKEE
FT                   IKHRHEENIKTVMKERKERIQPGSIELEKLAWKLGYNTALATFPGMCTWCANKDYTDVN
FT                   CASSQGECHHPTIRRPCLMGLGVRLDKTLEKLGIPFQKFPMDDTIPSQYTLILLD"
     MTIPEENYRI LKQTGGELGA KSVRLIPAEN IIIENRTILK CIFGCNGYGS QVCPPFIPTV        60
     DEFRQMLMEY QWALLVDWKS DNRFSREISE NFIKYSVTSP DKEEIKHRHE ENIKTVMKER       120
     KERIQPGSIE LEKLAWKLGY NTALATFPGM CTWCANKDYT DVNCASSQGE CHHPTIRRPC       180
     LMGLGVRLDK TLEKLGIPFQ KFPMDDTIPS QYTLILLD                               218
//

If you have problems or comments...

PBIL Back to PBIL home page