(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE147

CP001994.PE147       Location/Qualifiers
FT   CDS             178074..178298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0150"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TT27 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35685"
FT                   /db_xref="GOA:D5E934"
FT                   /db_xref="UniProtKB/TrEMBL:D5E934"
FT                   /protein_id="ADE35685.1"
FT                   /translation="MAYSAYLSIIGTGSIPPLVLAHGSLGIIALVLGALFVTNRWSWKT
FT                   KKYMRIELVLWLAVLLGGTYLYLAINGAI"
     MAYSAYLSII GTGSIPPLVL AHGSLGIIAL VLGALFVTNR WSWKTKKYMR IELVLWLAVL        60
     LGGTYLYLAI NGAI                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page