(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE149

CP001994.PE149       Location/Qualifiers
FT   CDS             181063..182118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0152"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8PWN2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35687"
FT                   /db_xref="GOA:D5E936"
FT                   /db_xref="UniProtKB/TrEMBL:D5E936"
FT                   /protein_id="ADE35687.1"
FT                   /translation="MKKIIYVTLLLMIFSISIGASAGVTSVPPHNTIDYYEVSGMPNIR
FT                   GSFLSNPEFEKGETRVIEVNLANKGVIQALRINVVPQDPPDIELAQNEMEKEKMRTVAQ
FT                   GVKAELGSSTDYIEVRPETSVYTLKALKPGMILEHPLRYTIDIDNNAPAGNYSLNLAVS
FT                   YSYQSQVRTVTNNEILRDVAENPYVSYYKNASTSITFPVEIKESPNFEITDSRGNISAD
FT                   EGSIINITYKNIGENVAEDASVKLVVMDPLEMEHSIATLGDVKPDETVTASFEFSTGRD
FT                   VIPKNYSISSSVKYFDDEGIQYSNVLSSKVEVLPSDKWMSLSTLALLIIMLLIIYLIGD
FT                   TVKNKRNNKGV"
     MKKIIYVTLL LMIFSISIGA SAGVTSVPPH NTIDYYEVSG MPNIRGSFLS NPEFEKGETR        60
     VIEVNLANKG VIQALRINVV PQDPPDIELA QNEMEKEKMR TVAQGVKAEL GSSTDYIEVR       120
     PETSVYTLKA LKPGMILEHP LRYTIDIDNN APAGNYSLNL AVSYSYQSQV RTVTNNEILR       180
     DVAENPYVSY YKNASTSITF PVEIKESPNF EITDSRGNIS ADEGSIINIT YKNIGENVAE       240
     DASVKLVVMD PLEMEHSIAT LGDVKPDETV TASFEFSTGR DVIPKNYSIS SSVKYFDDEG       300
     IQYSNVLSSK VEVLPSDKWM SLSTLALLII MLLIIYLIGD TVKNKRNNKG V                351
//

If you have problems or comments...

PBIL Back to PBIL home page