(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE15

CP001994.PE15        Location/Qualifiers
FT   CDS             complement(14982..15821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0015"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: sme:SMc00815
FT                   inositol-5-monophosphate dehydrogenase; PFAM: CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   SPTR: Q12V76 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35553"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P4"
FT                   /protein_id="ADE35553.1"
FT                   /translation="MNVSDIMSAPVYVIGTEEPVSHARKLMFRHKISTLIVVEEDEIKG
FT                   IVTKSDISSRLAQAEPMWRRRPIDKIPAKMVMTAEPIITIYPDASVSQAINLMLENQIN
FT                   NLPVFKNKLQGIVTIGDIVRYVADRALTTKISEVLTDDAVEVHRHHTINHVIDEMEKHR
FT                   VSKVIVINDMGDTVGMISTRDIALSAMEDNEGKMQSKNIKMARKPTQGGEKTYRYVKDV
FT                   PLVAEDIMVELDGVVNIEDNLSDAAKVMVENNRTGLPVEKEGKIVGILSRIDIIRAA"
     MNVSDIMSAP VYVIGTEEPV SHARKLMFRH KISTLIVVEE DEIKGIVTKS DISSRLAQAE        60
     PMWRRRPIDK IPAKMVMTAE PIITIYPDAS VSQAINLMLE NQINNLPVFK NKLQGIVTIG       120
     DIVRYVADRA LTTKISEVLT DDAVEVHRHH TINHVIDEME KHRVSKVIVI NDMGDTVGMI       180
     STRDIALSAM EDNEGKMQSK NIKMARKPTQ GGEKTYRYVK DVPLVAEDIM VELDGVVNIE       240
     DNLSDAAKVM VENNRTGLPV EKEGKIVGIL SRIDIIRAA                              279
//

If you have problems or comments...

PBIL Back to PBIL home page