(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE151

CP001994.PE151       Location/Qualifiers
FT   CDS             183262..183762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_0131 hypothetical protein; SPTR:
FT                   B7R091 Putative uncharacterized protein; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35689"
FT                   /db_xref="GOA:D5E938"
FT                   /db_xref="UniProtKB/TrEMBL:D5E938"
FT                   /protein_id="ADE35689.1"
FT                   /translation="MNAAVLLINGMALAGILIAFMDDRTKAILSINIAFKGFMQILPVT
FT                   LAIIIVIALFLGFVPPEQLSAFIGEQSGISGVLLIGIAGAIMHIPAILSFPLAASLLEK
FT                   GISYTAVAALITTLTMIGTVTLPLEISQLGKKFALLRNGISFVIAIIIALLVGVAMEAT
FT                   LWH"
     MNAAVLLING MALAGILIAF MDDRTKAILS INIAFKGFMQ ILPVTLAIII VIALFLGFVP        60
     PEQLSAFIGE QSGISGVLLI GIAGAIMHIP AILSFPLAAS LLEKGISYTA VAALITTLTM       120
     IGTVTLPLEI SQLGKKFALL RNGISFVIAI IIALLVGVAM EATLWH                      166
//

If you have problems or comments...

PBIL Back to PBIL home page