(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE155

CP001994.PE155       Location/Qualifiers
FT   CDS             186351..188096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0158"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197; KEGG: pca:Pcar_2049
FT                   pyruvate-formate lyase-activating enzyme; PFAM: Radical SAM
FT                   domain protein; SPTR: Q12YJ5 Fe-S protein, radical SAM
FT                   family; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35693"
FT                   /db_xref="GOA:D5E942"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D5E942"
FT                   /protein_id="ADE35693.1"
FT                   /translation="MKCNICEIGCDLAEGQSGQCRMYINKDDRIIERFSNNYFTMFPVS
FT                   IETVPLLHYYPRGTFLQVCTVGCNFKCEGCISEILASRLLSTNKKSGISNENVINKALH
FT                   EDCIGIVFCLNDPAVSYFTFCDLANKARENNLLIGCSTNGYFTENALKELIPLIDFVNI
FT                   GIKGYSDERYISCGARGSGPVFRNLKLLKESDVHVEVSTIYIKGSEDEVINTAKFVSSL
FT                   SRDISFQVMRFVPFGDAAPQIEPTIRESEVLCGKLKQYLNHVYLFNSPGTDHLNTVCAQ
FT                   CSNIIFQREFFGPMGSRTLSYLPQGMCECSNPALFRGEVSEVSYHEPGFMGGYRITRAL
FT                   EMIHAILVCLGVKDDHKLAEIWANVMETGYLEEFHASSQDLNSYFDVIEHFAALADRKK
FT                   EGMELVAYMREKLDFIRSVTNDIERPRVYYCMGYPLFALNGERIENNLVEAAGGESVNK
FT                   LINREGKPGVGISHNEFCDMNPEFIFISGFLSTPVSDSYAYCKKYGLSADAIKNRRIYD
FT                   LRPLWDFGSPRWILGLMYIANKLHPEIFNFDIDKEANQFYKRFYGVSFDSSRHNRSFYS
FT                   VSSRQ"
     MKCNICEIGC DLAEGQSGQC RMYINKDDRI IERFSNNYFT MFPVSIETVP LLHYYPRGTF        60
     LQVCTVGCNF KCEGCISEIL ASRLLSTNKK SGISNENVIN KALHEDCIGI VFCLNDPAVS       120
     YFTFCDLANK ARENNLLIGC STNGYFTENA LKELIPLIDF VNIGIKGYSD ERYISCGARG       180
     SGPVFRNLKL LKESDVHVEV STIYIKGSED EVINTAKFVS SLSRDISFQV MRFVPFGDAA       240
     PQIEPTIRES EVLCGKLKQY LNHVYLFNSP GTDHLNTVCA QCSNIIFQRE FFGPMGSRTL       300
     SYLPQGMCEC SNPALFRGEV SEVSYHEPGF MGGYRITRAL EMIHAILVCL GVKDDHKLAE       360
     IWANVMETGY LEEFHASSQD LNSYFDVIEH FAALADRKKE GMELVAYMRE KLDFIRSVTN       420
     DIERPRVYYC MGYPLFALNG ERIENNLVEA AGGESVNKLI NREGKPGVGI SHNEFCDMNP       480
     EFIFISGFLS TPVSDSYAYC KKYGLSADAI KNRRIYDLRP LWDFGSPRWI LGLMYIANKL       540
     HPEIFNFDID KEANQFYKRF YGVSFDSSRH NRSFYSVSSR Q                           581
//

If you have problems or comments...

PBIL Back to PBIL home page