(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE159

CP001994.PE159       Location/Qualifiers
FT   CDS             complement(191927..192724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0162"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="InterPro IPR013343; KEGG: DNA2; DNA helicase,
FT                   ssDNA-dependent ATPase, and endonuclease; K10742 DNA
FT                   replication ATP-dependent helicase Dna2; PFAM:
FT                   CRISPR-associated protein Cas4; SPTR: Q12UR5 Putative
FT                   uncharacterized protein; TIGRFAM: CRISPR-associated protein
FT                   Cas4; PFAM: Domain of unknown function DUF83; TIGRFAM:
FT                   CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35697"
FT                   /db_xref="GOA:D5E946"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D5E946"
FT                   /protein_id="ADE35697.1"
FT                   /translation="MCAMFCETNSNVSEVVLYTKCPRKIYFTSRNEVISNEIEKPYIRH
FT                   LLLKELALSCAEIAVSKQEILPLLQKRVEEIVQEIITIYSDELEHIDENQFKDALEDVY
FT                   EVLPAIAGNLKNQFDEEMIELIKPVEIEPLMHSDKLNLSGAPSAIICSDKQKIPMLIKT
FT                   GNAPMQGVWKNDRIPLAAYSILTEERYDQPVNSAVLFYASQGQARSVRIRPAERREVLN
FT                   ILKRIEKIKEGKMPQAKRGKLCGYCPYEQMCQSQGDSLASKFF"
     MCAMFCETNS NVSEVVLYTK CPRKIYFTSR NEVISNEIEK PYIRHLLLKE LALSCAEIAV        60
     SKQEILPLLQ KRVEEIVQEI ITIYSDELEH IDENQFKDAL EDVYEVLPAI AGNLKNQFDE       120
     EMIELIKPVE IEPLMHSDKL NLSGAPSAII CSDKQKIPML IKTGNAPMQG VWKNDRIPLA       180
     AYSILTEERY DQPVNSAVLF YASQGQARSV RIRPAERREV LNILKRIEKI KEGKMPQAKR       240
     GKLCGYCPYE QMCQSQGDSL ASKFF                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page