(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE164

CP001994.PE164       Location/Qualifiers
FT   CDS             196249..196764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0167"
FT                   /product="adenylyl cyclase CyaB"
FT                   /note="COGs: COG1437 Adenylate cyclase class 2
FT                   (thermophilic); InterPro IPR008172:IPR008173; KEGG:
FT                   vpa:VP1760 putative adenylate cyclase; PFAM: adenylate
FT                   cyclase; SPTR: Q12UR0 Adenylate cyclase; TIGRFAM: adenylyl
FT                   cyclase CyaB; PFAM: CYTH domain; TIGRFAM: adenylyl cyclase
FT                   CyaB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35702"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D5E951"
FT                   /protein_id="ADE35702.1"
FT                   /translation="MLEVEVKSRITLSHAREVLDRLDAKFLETEEHFDIYYNAPHRDFA
FT                   ETDEALRIRSVNDRQVLTYKGKKLDEVTKSREEIQTHVEAEAMIHILERLGFKETARVQ
FT                   KVRDVFKIGDITLCLDEVDSLGQFIEFEIISDADMEESKKRIFAMMENFGLKPEDSIRK
FT                   SYLELVME"
     MLEVEVKSRI TLSHAREVLD RLDAKFLETE EHFDIYYNAP HRDFAETDEA LRIRSVNDRQ        60
     VLTYKGKKLD EVTKSREEIQ THVEAEAMIH ILERLGFKET ARVQKVRDVF KIGDITLCLD       120
     EVDSLGQFIE FEIISDADME ESKKRIFAMM ENFGLKPEDS IRKSYLELVM E                171
//

If you have problems or comments...

PBIL Back to PBIL home page