(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE168

CP001994.PE168       Location/Qualifiers
FT   CDS             201585..202322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0171"
FT                   /product="SagB-type dehydrogenase domain protein"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro
FT                   IPR000415:IPR020051; KEGG: pca:Pcar_2755 nitroreductase;
FT                   PFAM: nitroreductase; SPTR: A3CSD8 Nitroreductase; TIGRFAM:
FT                   SagB-type dehydrogenase domain; PFAM: Nitroreductase
FT                   family; TIGRFAM: SagB-type dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35706"
FT                   /db_xref="GOA:D5E955"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5E955"
FT                   /protein_id="ADE35706.1"
FT                   /translation="MTGEGKRFMEATRFGELDPSPQMLGRSPPPLEIAPDADRSLISLP
FT                   EVDGLEMDSVDLKRAIEARRSIRNFTGSSLSLQDLAWLLWATQGVKKVMDDVATFRTVP
FT                   SAGARHSFETYLSIGNVEGLEQGLYRYLALEHSIVEEQQDENIMSKVAHACLDQSFVHN
FT                   CGAVFIWVAISERMGWRYGERGYRYLHLDAGHVCQNLYLASQAVKCGVCAVAAFKDDEL
FT                   NSLLGLDGDKHFVVYLAAVGKRD"
     MTGEGKRFME ATRFGELDPS PQMLGRSPPP LEIAPDADRS LISLPEVDGL EMDSVDLKRA        60
     IEARRSIRNF TGSSLSLQDL AWLLWATQGV KKVMDDVATF RTVPSAGARH SFETYLSIGN       120
     VEGLEQGLYR YLALEHSIVE EQQDENIMSK VAHACLDQSF VHNCGAVFIW VAISERMGWR       180
     YGERGYRYLH LDAGHVCQNL YLASQAVKCG VCAVAAFKDD ELNSLLGLDG DKHFVVYLAA       240
     VGKRD                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page