(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE169

CP001994.PE169       Location/Qualifiers
FT   CDS             complement(202324..203250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0172"
FT                   /product="ribose 1,5-bisphosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /EC_number="5.3.1.-"
FT                   /note="COGs: COG1184 Translation initiation factor 2B
FT                   subunit eIF-2B alpha/beta/delta family; InterPro
FT                   IPR000649:IPR011559:IPR005250; KEGG: gur:Gura_4322 aIF-2BI
FT                   family translation initiation factor; PFAM: initiation
FT                   factor 2B related; PRIAM: S-methyl-5-thioribose-1-phosphate
FT                   isomerase; SPTR: Q12UQ7 Ribose 1,5-bisphosphate isomerase;
FT                   TIGRFAM: translation initiation factor, aIF-2BII family;
FT                   eIF-2B alpha/beta/delta-related uncharacterized protein;
FT                   PFAM: Initiation factor 2 subunit family; TIGRFAM: eIF-2B
FT                   alpha/beta/delta-related uncharacterized proteins;
FT                   ribose-1,5-bisphosphate isomerase, e2b2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35707"
FT                   /db_xref="GOA:D5E956"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005250"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D5E956"
FT                   /protein_id="ADE35707.1"
FT                   /translation="MQQLLDTAEKIRSMEIRGAGRIATAAAKALRDYVEMLETSSFEEF
FT                   VAKVEKAKSILIETRPTAVSLPNAVMLAGSYDAETVEEARSQILDNATEFIRNADNALD
FT                   NIGEIGAKRLRDGDTVMTHCNSHAALAIIKTAHKQGKRIKVYATESRPRRQGFITIKEL
FT                   SDAGIDTTLIVDSAVRYTMKNVDTVIVGADSITVNGALVNKIGTSQLALAAHEARVNFI
FT                   SAAETYKFSPSTLFGDLVEIEERDPDEVIPSDKLGDMPDVKISNPAFDVTPSEYIDLIV
FT                   TEAGAFPPEMAYVIIKEHLGWELKKMG"
     MQQLLDTAEK IRSMEIRGAG RIATAAAKAL RDYVEMLETS SFEEFVAKVE KAKSILIETR        60
     PTAVSLPNAV MLAGSYDAET VEEARSQILD NATEFIRNAD NALDNIGEIG AKRLRDGDTV       120
     MTHCNSHAAL AIIKTAHKQG KRIKVYATES RPRRQGFITI KELSDAGIDT TLIVDSAVRY       180
     TMKNVDTVIV GADSITVNGA LVNKIGTSQL ALAAHEARVN FISAAETYKF SPSTLFGDLV       240
     EIEERDPDEV IPSDKLGDMP DVKISNPAFD VTPSEYIDLI VTEAGAFPPE MAYVIIKEHL       300
     GWELKKMG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page