(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE17

CP001994.PE17        Location/Qualifiers
FT   CDS             complement(16902..17654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0017"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: rpa:RPA4246
FT                   CBS/transport-associated domain-containing protein; PFAM:
FT                   CBS domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: Q12V74 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35555"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P6"
FT                   /protein_id="ADE35555.1"
FT                   /translation="MSGDAVYLHESDTVTHARQLMRDHFLRGIPVVNDNGKVSGMITDK
FT                   DILKVASTKSNVTVAGFVNSVPQITPETDIYKAASLLLEAKLERCPVVKSSIEQNLVGI
FT                   VSNTDLLGKMVNRDLSKPVREIMTSPPTTCKPTDNIGEIWSAMLENDYTGLPVVSKKGK
FT                   LMGMITRRDLIKSGFARIGVREKDGSTHNQPVEKVMSTPAYSIKQDTSVKECTEKVLHY
FT                   DVGRLTVDVEDKPVGIVDRSDLLRAYTE"
     MSGDAVYLHE SDTVTHARQL MRDHFLRGIP VVNDNGKVSG MITDKDILKV ASTKSNVTVA        60
     GFVNSVPQIT PETDIYKAAS LLLEAKLERC PVVKSSIEQN LVGIVSNTDL LGKMVNRDLS       120
     KPVREIMTSP PTTCKPTDNI GEIWSAMLEN DYTGLPVVSK KGKLMGMITR RDLIKSGFAR       180
     IGVREKDGST HNQPVEKVMS TPAYSIKQDT SVKECTEKVL HYDVGRLTVD VEDKPVGIVD       240
     RSDLLRAYTE                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page