(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE173

CP001994.PE173       Location/Qualifiers
FT   CDS             205366..206187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0176"
FT                   /product="protein of unknown function Met10"
FT                   /note="COGs: COG2520 methyltransferase; InterPro IPR003402;
FT                   KEGG: dps:DP0629 hypothetical protein; PFAM: protein of
FT                   unknown function Met10; SPTR: Q0W4W1 Putative
FT                   uncharacterized protein; PFAM: Met-10+ like-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35711"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D5E960"
FT                   /protein_id="ADE35711.1"
FT                   /translation="MSKNSLKTLVEKEVPADLIEYIPNRFDVVGDIAIVSIPPELWDYS
FT                   EMIATKVVSMRGNIGTVLNKISRVKGDHRVSDFKILLGGSTVTTHGEFKYRYRLDLSEV
FT                   FFNPRLGYERHRVTSLVLPREDVLVAFCGVGPFAIPAAIRDVRVFCVEKNRYACHWLAE
FT                   NIRLNNFKGHIYPINADARDIPVILDMKFDRLIVPTPYGQDHFFSLLSPLLKEGGMMHF
FT                   YTFQVAEDIAKSKQAFKDAGYEIIGVRRCGNVARGVSRWVFDLKKNRPAKR"
     MSKNSLKTLV EKEVPADLIE YIPNRFDVVG DIAIVSIPPE LWDYSEMIAT KVVSMRGNIG        60
     TVLNKISRVK GDHRVSDFKI LLGGSTVTTH GEFKYRYRLD LSEVFFNPRL GYERHRVTSL       120
     VLPREDVLVA FCGVGPFAIP AAIRDVRVFC VEKNRYACHW LAENIRLNNF KGHIYPINAD       180
     ARDIPVILDM KFDRLIVPTP YGQDHFFSLL SPLLKEGGMM HFYTFQVAED IAKSKQAFKD       240
     AGYEIIGVRR CGNVARGVSR WVFDLKKNRP AKR                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page