(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE175

CP001994.PE175       Location/Qualifiers
FT   CDS             207680..208783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0178"
FT                   /product="cell division protein FtsZ"
FT                   /note="COGs: COG0206 Cell division GTPase; InterPro
FT                   IPR000158:IPR018316:IPR003008; KEGG: plastid division
FT                   protein FtsZ (AB032072); K03531 cell division protein FtsZ;
FT                   PFAM: Tubulin/FtsZ GTPase; Tubulin/FtsZ, 2-layer sandwich
FT                   domain; SPTR: Q12UQ3 Cell division protein ftsZ; TIGRFAM:
FT                   cell division protein FtsZ; PFAM: Tubulin/FtsZ family,
FT                   GTPase domain; FtsZ family, C-terminal domain; TIGRFAM:
FT                   cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35713"
FT                   /db_xref="GOA:D5E962"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D5E962"
FT                   /protein_id="ADE35713.1"
FT                   /translation="MKSIVEEALARSAEERQVSSEPSGPKDVNAEIEAVLKGMHTNIKV
FT                   IGCGGGGSNSIQRMTNEGIKGAQLVALNTDAQHLLNVICDNKILIGKKKTRGLGAGSLP
FT                   QIGEDAALESIDELTEVVDGTDMVFITAGLGGGTGTGSAAVVAEAARDAGALTIAVVTL
FT                   PFAVEGEVRRTNAEAGLERLRDVADTVIVVPNDKLLEVVPRLPLQAAFKVSDEVLMRAV
FT                   KGITELITKPGLVNLDFADVRTVMQNGGVAMIGLGEADGDSKASESVQKALRSPLLDVD
FT                   ISGATSALVNVVGGQDMTVSEAEGVVQEVYSRIDPGARLIWGAQVDPELEHTVRTMIVV
FT                   TGVKSPQIYGPGGAKNVTRRYGIDFVG"
     MKSIVEEALA RSAEERQVSS EPSGPKDVNA EIEAVLKGMH TNIKVIGCGG GGSNSIQRMT        60
     NEGIKGAQLV ALNTDAQHLL NVICDNKILI GKKKTRGLGA GSLPQIGEDA ALESIDELTE       120
     VVDGTDMVFI TAGLGGGTGT GSAAVVAEAA RDAGALTIAV VTLPFAVEGE VRRTNAEAGL       180
     ERLRDVADTV IVVPNDKLLE VVPRLPLQAA FKVSDEVLMR AVKGITELIT KPGLVNLDFA       240
     DVRTVMQNGG VAMIGLGEAD GDSKASESVQ KALRSPLLDV DISGATSALV NVVGGQDMTV       300
     SEAEGVVQEV YSRIDPGARL IWGAQVDPEL EHTVRTMIVV TGVKSPQIYG PGGAKNVTRR       360
     YGIDFVG                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page