(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE180

CP001994.PE180       Location/Qualifiers
FT   CDS             210910..211947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0183"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="COGs: COG0244 Ribosomal protein L10; InterPro
FT                   IPR001790; KEGG: RPP0; Conserved ribosomal protein P0
FT                   similar to rat P0, human P0, and E. coli L10e; shown to be
FT                   phosphorylated on serine 302; K02941 large subunit
FT                   ribosomal protein LP0; PFAM: ribosomal protein L10; SPTR:
FT                   Q12UP8 Acidic ribosomal protein P0 homolog; PFAM: Ribosomal
FT                   protein L10; 60s Acidic ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35718"
FT                   /db_xref="GOA:D5E967"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022909"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:D5E967"
FT                   /protein_id="ADE35718.1"
FT                   /translation="MMEEELHHSEHIPQWKKQEIEDIKALIEKYPLFGIVGVGGIPAKQ
FT                   LQAMRRELKDVAVLKVCRNTLVNRALESSSKDCSEMIDYLNQQCALIFTNENPFKLYKL
FT                   LEQSKTPSPIKAGAIAPQDIKVEKGPTSFPPGPILGDLQSAGIPASIDGGKVVVSENKV
FT                   VTEEGNVVSQNLASMLARLEIFPIEVGLDLHAVFEDGSIFTPDVLAIDNDKYFSDIAAA
FT                   SRQAFNLAVNVAYPTTATISTLISKASSEAMNLGINATVLEPEIMDSLLGKAHSQMISL
FT                   ASAVSANNEDAVDEDLKSVLGAAAQSAAATVEEQPAEEAAEEEVEEEEEDAEEGGMAGL
FT                   GALFG"
     MMEEELHHSE HIPQWKKQEI EDIKALIEKY PLFGIVGVGG IPAKQLQAMR RELKDVAVLK        60
     VCRNTLVNRA LESSSKDCSE MIDYLNQQCA LIFTNENPFK LYKLLEQSKT PSPIKAGAIA       120
     PQDIKVEKGP TSFPPGPILG DLQSAGIPAS IDGGKVVVSE NKVVTEEGNV VSQNLASMLA       180
     RLEIFPIEVG LDLHAVFEDG SIFTPDVLAI DNDKYFSDIA AASRQAFNLA VNVAYPTTAT       240
     ISTLISKASS EAMNLGINAT VLEPEIMDSL LGKAHSQMIS LASAVSANNE DAVDEDLKSV       300
     LGAAAQSAAA TVEEQPAEEA AEEEVEEEEE DAEEGGMAGL GALFG                       345
//

If you have problems or comments...

PBIL Back to PBIL home page