(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE186

CP001994.PE186       Location/Qualifiers
FT   CDS             complement(217164..217910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0189"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG1235 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily I; InterPro IPR001279; KEGG:
FT                   gem:GM21_0314 beta-lactamase domain protein; PFAM:
FT                   beta-lactamase domain protein; SPTR: Q12UP1
FT                   Beta-lactamase-like protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35724"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5E973"
FT                   /protein_id="ADE35724.1"
FT                   /translation="MKVTLLGTGDAPGTPIIGCNCLTCQDGLKGGKSNRLRCSILVESE
FT                   KGTILLDTGPDLRQQLLEHNIKHVDGVIWTHGHYDHFTGFGEFHRVQRKVDVYGLAETL
FT                   DYILEYLAFLRPRRNNVKINETFEIIGLRITLFEVKHRPVSNPVGVIIEENGKKVVFTG
FT                   DCERQIPQKSLEMIDSPDLLIADAIVPDSDVLHIKKHMDAKDALELAQKIKAKEVVFTH
FT                   ISHFFKPHSIAAQEFPMGYDGMQFVI"
     MKVTLLGTGD APGTPIIGCN CLTCQDGLKG GKSNRLRCSI LVESEKGTIL LDTGPDLRQQ        60
     LLEHNIKHVD GVIWTHGHYD HFTGFGEFHR VQRKVDVYGL AETLDYILEY LAFLRPRRNN       120
     VKINETFEII GLRITLFEVK HRPVSNPVGV IIEENGKKVV FTGDCERQIP QKSLEMIDSP       180
     DLLIADAIVP DSDVLHIKKH MDAKDALELA QKIKAKEVVF THISHFFKPH SIAAQEFPMG       240
     YDGMQFVI                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page