(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE187

CP001994.PE187       Location/Qualifiers
FT   CDS             complement(217911..219197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0190"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003959:IPR011704:IPR003593:IPR003960; KEGG:
FT                   sfu:Sfum_2326 ATPase central domain-containing protein;
FT                   PFAM: AAA ATPase central domain protein; ATPase associated
FT                   with various cellular activities AAA_5; SMART: AAA ATPase;
FT                   SPTR: Q12UP0 AAA ATPase; PFAM: ATPase family associated
FT                   with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35725"
FT                   /db_xref="GOA:D5E974"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E974"
FT                   /protein_id="ADE35725.1"
FT                   /translation="MSDNTLDIIELLLTAQIYNQNQVLDVNDLPKPIRKHYWKKEAKGV
FT                   PRPIHVSLTDVNKLYGESETKKALKGLPFVEIDEVGYKIKLTSLDMAISWFEKQDTARR
FT                   IEENPALAYYFEKAEKEGVSYNKARDSTKPKEVDREWIESLKAEVMEEEGGEDMLKLAQ
FT                   LLAPEDIQQGMSELILTKKQESEVDKIVKAIKFRDYLKEIGLYDVGKVLLVGPPGTGKT
FT                   SVARALSEMLSIPFVEVKLSMITDQYLGETAKNIDRVFELAKKLNPCILFVDEFDFIAK
FT                   TRTSDEHAALKRAVNTLLKAIDEISLTRDGVLLIAATNHPHMLDSAAWRRFDEILEFPL
FT                   PDYDMRKNILDIVTRHIKGNFDTAAIAEITEGYTGSDLRVVIREGVLDALLEERRELSN
FT                   KDLIDAVESFNNRSHIKSEKYLQQYDRVS"
     MSDNTLDIIE LLLTAQIYNQ NQVLDVNDLP KPIRKHYWKK EAKGVPRPIH VSLTDVNKLY        60
     GESETKKALK GLPFVEIDEV GYKIKLTSLD MAISWFEKQD TARRIEENPA LAYYFEKAEK       120
     EGVSYNKARD STKPKEVDRE WIESLKAEVM EEEGGEDMLK LAQLLAPEDI QQGMSELILT       180
     KKQESEVDKI VKAIKFRDYL KEIGLYDVGK VLLVGPPGTG KTSVARALSE MLSIPFVEVK       240
     LSMITDQYLG ETAKNIDRVF ELAKKLNPCI LFVDEFDFIA KTRTSDEHAA LKRAVNTLLK       300
     AIDEISLTRD GVLLIAATNH PHMLDSAAWR RFDEILEFPL PDYDMRKNIL DIVTRHIKGN       360
     FDTAAIAEIT EGYTGSDLRV VIREGVLDAL LEERRELSNK DLIDAVESFN NRSHIKSEKY       420
     LQQYDRVS                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page