(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE19

CP001994.PE19        Location/Qualifiers
FT   CDS             complement(18487..19899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0019"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358:IPR003594:IPR005467; KEGG:
FT                   afw:Anae109_3161 PAS/PAC sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   SPTR: Q12XC6 ATP-binding region, ATPase-like protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35557"
FT                   /db_xref="GOA:D5E8P8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P8"
FT                   /protein_id="ADE35557.1"
FT                   /translation="MESKPPIILLSNDLYYHGTGLTSNKERLKDASILNIQDFENRDPE
FT                   SQQEVLESHGTLYIITSANEGSLPQVLNTCDNEIYRIKAEECRDTEKYACPYILNAKLM
FT                   ELLLEQREAEIRKLNEQMSSYLIAMDSIYTLSSYDRKEDIINHTKEFFAMMCLPENLCY
FT                   FEAHNTKAQSGIHLTDFQKKDIVAFLKSNKYYKIAPSEKSFCFRLTLQDGDEGIFVLEN
FT                   IAYQSRLHEFLNLTLSIRSVLTVVLENISKQNELEKSHNLLADANDMLKVINKILRHDL
FT                   ANNLGAIKMSLEMNETRPNPKYIQISKKAVDRSFQKINDMKGLENLIGTGKDLDCYEVK
FT                   EIIEKTAGTDIEMDISIEGQCKVLADNALSSVFENIIKNAIAHGKANKMRIKMEPSGKY
FT                   CHISIVDNGTGIPDEIKPKIFKEGFTEGGDSNSGLGLYISKKVIERYGGQIEVKDNTPH
FT                   GAKFVLDIPSTK"
     MESKPPIILL SNDLYYHGTG LTSNKERLKD ASILNIQDFE NRDPESQQEV LESHGTLYII        60
     TSANEGSLPQ VLNTCDNEIY RIKAEECRDT EKYACPYILN AKLMELLLEQ REAEIRKLNE       120
     QMSSYLIAMD SIYTLSSYDR KEDIINHTKE FFAMMCLPEN LCYFEAHNTK AQSGIHLTDF       180
     QKKDIVAFLK SNKYYKIAPS EKSFCFRLTL QDGDEGIFVL ENIAYQSRLH EFLNLTLSIR       240
     SVLTVVLENI SKQNELEKSH NLLADANDML KVINKILRHD LANNLGAIKM SLEMNETRPN       300
     PKYIQISKKA VDRSFQKIND MKGLENLIGT GKDLDCYEVK EIIEKTAGTD IEMDISIEGQ       360
     CKVLADNALS SVFENIIKNA IAHGKANKMR IKMEPSGKYC HISIVDNGTG IPDEIKPKIF       420
     KEGFTEGGDS NSGLGLYISK KVIERYGGQI EVKDNTPHGA KFVLDIPSTK                  470
//

If you have problems or comments...

PBIL Back to PBIL home page