(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE192

CP001994.PE192       Location/Qualifiers
FT   CDS             224596..224946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0196"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TQY1 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35730"
FT                   /db_xref="UniProtKB/TrEMBL:D5E979"
FT                   /protein_id="ADE35730.1"
FT                   /translation="MAKKWMLVLLLVLTVSFAGCVNKDSLVERTNDSLLEESKDIAEAY
FT                   VLNHEDYMRYSVTEPVFLGSEKLDCSNCWSFTYEFDLISAKDPDVIDTATINVTVKDLE
FT                   VVETVYSQGMKD"
     MAKKWMLVLL LVLTVSFAGC VNKDSLVERT NDSLLEESKD IAEAYVLNHE DYMRYSVTEP        60
     VFLGSEKLDC SNCWSFTYEF DLISAKDPDV IDTATINVTV KDLEVVETVY SQGMKD           116
//

If you have problems or comments...

PBIL Back to PBIL home page