(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE195

CP001994.PE195       Location/Qualifiers
FT   CDS             228532..229080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0199"
FT                   /product="BioY protein"
FT                   /note="COGs: COG1268 conserved hypothetical protein;
FT                   InterPro IPR003784; KEGG: sat:SYN_00210 hypothetical
FT                   protein; PFAM: BioY protein; SPTR: Q12UN5 BioY protein;
FT                   PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35733"
FT                   /db_xref="GOA:D5E982"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D5E982"
FT                   /protein_id="ADE35733.1"
FT                   /translation="MVNNTNLSDSPVRKMVYAALFASMTAVGAYISIPVGLVPVTLQTL
FT                   FVILAGAVLGARWGMLSMFIYVLLGIVGLPVFSGGSSGLGVLAGPTGGYIIGFILAALV
FT                   IGYLFEKFQYRSIVSMVAIFLVGMIAIYVPGYFQLMYVASLGMEETFALGVAPFIPGAA
FT                   IKIAAATIIYRYLKTESLV"
     MVNNTNLSDS PVRKMVYAAL FASMTAVGAY ISIPVGLVPV TLQTLFVILA GAVLGARWGM        60
     LSMFIYVLLG IVGLPVFSGG SSGLGVLAGP TGGYIIGFIL AALVIGYLFE KFQYRSIVSM       120
     VAIFLVGMIA IYVPGYFQLM YVASLGMEET FALGVAPFIP GAAIKIAAAT IIYRYLKTES       180
     LV                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page