(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE198

CP001994.PE198       Location/Qualifiers
FT   CDS             230682..231476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0202"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: sat:SYN_00208 ABC-type cobalt transport
FT                   system, permease component; PFAM: cobalt transport protein;
FT                   SPTR: Q12UN2 Cobalt ABC transporter, inner membrane
FT                   subunit; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35736"
FT                   /db_xref="GOA:D5E985"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D5E985"
FT                   /protein_id="ADE35736.1"
FT                   /translation="MPDYFLSFVPGDSFLHRLDPRTKLIATMLISILIFRLHITGLVLL
FT                   FALFMVLYYLSSVRIAMLRNLHPIAPFLIFIFIFQLFLIPGNSFMDIYGFSATSEGFFE
FT                   GLRIVGRFVLLIQFASLLTATTSPAHMAAGIERLLRPLPGKVLGVTSFDIATMMSLSIH
FT                   LVPVLNRFLKEVYQAQLCRGLGRQKRISGLVSLAIPLLRGAFRMMDDISMGMESRCYQG
FT                   NYRTSLFELKMEKYDWMVLMLVFVLLLAFWDLSITLLPSYQI"
     MPDYFLSFVP GDSFLHRLDP RTKLIATMLI SILIFRLHIT GLVLLFALFM VLYYLSSVRI        60
     AMLRNLHPIA PFLIFIFIFQ LFLIPGNSFM DIYGFSATSE GFFEGLRIVG RFVLLIQFAS       120
     LLTATTSPAH MAAGIERLLR PLPGKVLGVT SFDIATMMSL SIHLVPVLNR FLKEVYQAQL       180
     CRGLGRQKRI SGLVSLAIPL LRGAFRMMDD ISMGMESRCY QGNYRTSLFE LKMEKYDWMV       240
     LMLVFVLLLA FWDLSITLLP SYQI                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page