(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE2

CP001994.PE2         Location/Qualifiers
FT   CDS             complement(1457..2011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0002"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="InterPro IPR001733; KEGG: hypothetical protein;
FT                   K03100 signal peptidase I; SPTR: Q12VA0 Peptidase S26B,
FT                   signal peptidase; TIGRFAM: peptidase S26B, signal
FT                   peptidase; PFAM: Peptidase S24-like; TIGRFAM: signal
FT                   peptidase I, archaeal type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35540"
FT                   /db_xref="GOA:D5E8N1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N1"
FT                   /protein_id="ADE35540.1"
FT                   /translation="MEIGEIIHTFKNSDNFWVGIARDALSVLAILAVIGILSQLFFGMW
FT                   TPMVAVESGSMEPHMYRGDIIFIEDLDRTRIETLRDAPEDYISFEKKGDVILYRPYGQK
FT                   GVTPVIHRAMYFVEEGEQMWEGGPDAPHEGYITKGDNKKTNSYYDQQGQISYLAPVKEE
FT                   WIIGVARYKVPYIGHIRLLLS"
     MEIGEIIHTF KNSDNFWVGI ARDALSVLAI LAVIGILSQL FFGMWTPMVA VESGSMEPHM        60
     YRGDIIFIED LDRTRIETLR DAPEDYISFE KKGDVILYRP YGQKGVTPVI HRAMYFVEEG       120
     EQMWEGGPDA PHEGYITKGD NKKTNSYYDQ QGQISYLAPV KEEWIIGVAR YKVPYIGHIR       180
     LLLS                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page