(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE202

CP001994.PE202       Location/Qualifiers
FT   CDS             complement(235341..235706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0206"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8Q004 Putative uncharacterized protein; PFAM:
FT                   DsrE/DsrF-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35740"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:D5E989"
FT                   /protein_id="ADE35740.1"
FT                   /translation="MHKVTNVLILLKSMIYESTGPLETLRFAKHYSEQGLNVNIVLFGP
FT                   MGVMLAKKDKAGALEYDKKVDECMNLGVNFMCCKLGSSLVGLKYEEMIPGIEMVEPEAI
FT                   ADTILEFSQKQQLIITL"
     MHKVTNVLIL LKSMIYESTG PLETLRFAKH YSEQGLNVNI VLFGPMGVML AKKDKAGALE        60
     YDKKVDECMN LGVNFMCCKL GSSLVGLKYE EMIPGIEMVE PEAIADTILE FSQKQQLIIT       120
     L                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page