(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE209

CP001994.PE209       Location/Qualifiers
FT   CDS             241713..242099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0214"
FT                   /product="Protein of unknown function DUF2178,
FT                   transmembrane"
FT                   /note="InterPro IPR019235; PFAM: Protein of unknown
FT                   function DUF2178, transmembrane; SPTR: Q12Z30 Putative
FT                   uncharacterized protein; PFAM: Predicted membrane protein
FT                   (DUF2178)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35747"
FT                   /db_xref="GOA:D5E996"
FT                   /db_xref="InterPro:IPR019235"
FT                   /db_xref="UniProtKB/TrEMBL:D5E996"
FT                   /protein_id="ADE35747.1"
FT                   /translation="MQVKEIGMLTIGFILFLIGLGFYILEPAWIINPSGTGGAFIGAGV
FT                   ALFLITLREIRLKSKGNIVEDERVFHIAEKASHKTLVILIVLEGTLMAFLGVTAFDIQA
FT                   YPVVSLLFAITMISYAGFYYWYKK"
     MQVKEIGMLT IGFILFLIGL GFYILEPAWI INPSGTGGAF IGAGVALFLI TLREIRLKSK        60
     GNIVEDERVF HIAEKASHKT LVILIVLEGT LMAFLGVTAF DIQAYPVVSL LFAITMISYA       120
     GFYYWYKK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page