(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE21

CP001994.PE21        Location/Qualifiers
FT   CDS             complement(20946..21593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0021"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="COGs: COG5012 cobalamin binding protein; InterPro
FT                   IPR006158; KEGG: ppd:Ppro_1431 cobalamin B12-binding
FT                   domain-containing protein; PFAM: cobalamin B12-binding
FT                   domain protein; SPTR: Q12XC8 Cobalamin B12-binding protein;
FT                   PFAM: B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35559"
FT                   /db_xref="GOA:D5E8Q0"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q0"
FT                   /protein_id="ADE35559.1"
FT                   /translation="MDRLNKNKALDFENALLEFDRVHAEQILEDALSENNTFQVIDEIV
FT                   SPALTRIGTAWDTGEIALSQNYMAGKIAEQLMDEILPAESPERIAYPKIAITTLGDYHM
FT                   LGKKVVTSMLRTTGHSIKEYDSMNLDQLVEKLNEDGIDLLLTSTLMLNIALKIRELKKH
FT                   MDKKGLKTKVIAGGAPFLFDDMLYREVGADYMARTSSDVYKLIDQYKEEVHK"
     MDRLNKNKAL DFENALLEFD RVHAEQILED ALSENNTFQV IDEIVSPALT RIGTAWDTGE        60
     IALSQNYMAG KIAEQLMDEI LPAESPERIA YPKIAITTLG DYHMLGKKVV TSMLRTTGHS       120
     IKEYDSMNLD QLVEKLNEDG IDLLLTSTLM LNIALKIREL KKHMDKKGLK TKVIAGGAPF       180
     LFDDMLYREV GADYMARTSS DVYKLIDQYK EEVHK                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page