(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE210

CP001994.PE210       Location/Qualifiers
FT   CDS             242124..242318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0215"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1476 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: shl:Shal_4180 XRE family
FT                   transcriptional regulator; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   Q12Z31 Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35748"
FT                   /db_xref="GOA:D5E997"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E997"
FT                   /protein_id="ADE35748.1"
FT                   /translation="MKNTLKVWRAKKDITQEELAREMEVTRQTINAIERGKYDPSIKLA
FT                   FRMAKFFECSIEDIFIYEE"
     MKNTLKVWRA KKDITQEELA REMEVTRQTI NAIERGKYDP SIKLAFRMAK FFECSIEDIF        60
     IYEE                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page